BLASTX nr result
ID: Perilla23_contig00004497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00004497 (718 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094637.1| PREDICTED: probable receptor-like protein ki... 68 7e-09 ref|XP_011094636.1| PREDICTED: probable receptor-like protein ki... 68 7e-09 >ref|XP_011094637.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Sesamum indicum] gi|747093646|ref|XP_011094638.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Sesamum indicum] gi|747093648|ref|XP_011094639.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Sesamum indicum] Length = 425 Score = 67.8 bits (164), Expect = 7e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 713 NKEQKETSEEPEAKGKRRISDIKFVDSSWLLRVWSSKLVRTC 588 +KEQK+ EEPEAKGKRRI+D+K D WL+RVWSSKLV+TC Sbjct: 384 SKEQKKKFEEPEAKGKRRIADMKIGDGGWLVRVWSSKLVKTC 425 >ref|XP_011094636.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X1 [Sesamum indicum] Length = 436 Score = 67.8 bits (164), Expect = 7e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 713 NKEQKETSEEPEAKGKRRISDIKFVDSSWLLRVWSSKLVRTC 588 +KEQK+ EEPEAKGKRRI+D+K D WL+RVWSSKLV+TC Sbjct: 395 SKEQKKKFEEPEAKGKRRIADMKIGDGGWLVRVWSSKLVKTC 436