BLASTX nr result
ID: Perilla23_contig00004329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00004329 (510 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855139.1| PREDICTED: pentatricopeptide repeat-containi... 157 4e-36 ref|XP_011099596.1| PREDICTED: pentatricopeptide repeat-containi... 156 7e-36 gb|AEI98618.1| hypothetical protein 111O18.5 [Coffea canephora] 139 1e-30 emb|CDP02821.1| unnamed protein product [Coffea canephora] 136 7e-30 gb|ABU45207.1| unknown [Solanum bulbocastanum] 134 3e-29 ref|XP_006363148.1| PREDICTED: pentatricopeptide repeat-containi... 132 1e-28 ref|XP_009795026.1| PREDICTED: pentatricopeptide repeat-containi... 130 3e-28 ref|XP_009626271.1| PREDICTED: pentatricopeptide repeat-containi... 130 5e-28 ref|XP_004232380.1| PREDICTED: pentatricopeptide repeat-containi... 129 7e-28 gb|ABU45173.1| unknown [Solanum melongena] 127 3e-27 gb|ABU45192.1| unknown [Petunia integrifolia subsp. inflata] 126 6e-27 ref|XP_004233512.1| PREDICTED: pentatricopeptide repeat-containi... 125 1e-26 ref|XP_011654338.1| PREDICTED: pentatricopeptide repeat-containi... 122 1e-25 gb|KGN53262.1| hypothetical protein Csa_4G038790 [Cucumis sativus] 122 1e-25 ref|XP_007046988.1| Tetratricopeptide repeat (TPR)-like superfam... 122 1e-25 gb|ABU45188.1| unknown [Capsicum frutescens] 122 1e-25 ref|XP_012436918.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_009627584.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_008453729.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 ref|XP_008338124.1| PREDICTED: pentatricopeptide repeat-containi... 121 2e-25 >ref|XP_012855139.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Erythranthe guttatus] gi|604346179|gb|EYU44676.1| hypothetical protein MIMGU_mgv1a018688mg [Erythranthe guttata] Length = 420 Score = 157 bits (396), Expect = 4e-36 Identities = 80/122 (65%), Positives = 93/122 (76%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVYDDLLK++G +PNAATFRT VFH CK R+ YK+FK S KVGKIPDFNTLK+ Sbjct: 292 DEAKKVYDDLLKSKGSKPNAATFRTWVFHLCKKGRFTTGYKVFKQSAKVGKIPDFNTLKY 351 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSEVVNGAS 150 LV GL K G L EAK +VRTMNKKF PELLK+WE+LA +LG+ + AEEV S V A Sbjct: 352 LVEGLVKEGNLSEAKALVRTMNKKFAPELLKAWEKLAGDLGL--IVAEEVVGSGEVEAAG 409 Query: 149 SD 144 D Sbjct: 410 VD 411 >ref|XP_011099596.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Sesamum indicum] Length = 420 Score = 156 bits (394), Expect = 7e-36 Identities = 78/131 (59%), Positives = 99/131 (75%), Gaps = 1/131 (0%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVYDDL K +G+ PNAATFRT+VFH CK R+V AYK+FK SVK KIPDFNTLK+ Sbjct: 291 DEAKKVYDDLSKVKGLNPNAATFRTLVFHLCKKGRFVTAYKVFKKSVKAHKIPDFNTLKY 350 Query: 329 LVTGLTK-TGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSEVVNGA 153 L+ GL K G + + K M+RTMNKKFPP+LLK+W +L E+LG+A + EEV++ E+ G Sbjct: 351 LLEGLAKEEGHMDDCKAMIRTMNKKFPPKLLKAWGKLVEDLGLANVGNEEVNSGEIEIGV 410 Query: 152 SSDVGTEKANT 120 S EKA+T Sbjct: 411 DS-ADAEKAST 420 >gb|AEI98618.1| hypothetical protein 111O18.5 [Coffea canephora] Length = 417 Score = 139 bits (349), Expect = 1e-30 Identities = 66/114 (57%), Positives = 85/114 (74%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA KVY+DL + G +PNAATFRT++F+ CK +R+ YK+FK SV V KIPDFNTLKH Sbjct: 304 DEAFKVYEDL-EGNGCKPNAATFRTLIFYLCKRQRFETGYKVFKESVAVHKIPDFNTLKH 362 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSE 168 L+ GL K + EAKGM+RT+ KKFPP ++K+WE L +ELG+ + A EVD E Sbjct: 363 LLEGLVKRSKFKEAKGMIRTVKKKFPPNVVKAWERLQKELGLVSVEANEVDLEE 416 >emb|CDP02821.1| unnamed protein product [Coffea canephora] Length = 417 Score = 136 bits (342), Expect = 7e-30 Identities = 65/114 (57%), Positives = 83/114 (72%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA KVY+DL + G +PNAATFRT++F+ CK +R+ YK+FK SV V KIPDFNTLKH Sbjct: 304 DEAFKVYEDL-EGNGCKPNAATFRTLIFYLCKRQRFETGYKVFKESVAVHKIPDFNTLKH 362 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSE 168 L+ GL K + EAKGM+R + KKFPP ++K+WE L +ELG+ A EVD E Sbjct: 363 LLEGLVKRSKFKEAKGMIRAVKKKFPPNVVKAWERLQKELGLVSAEANEVDLEE 416 >gb|ABU45207.1| unknown [Solanum bulbocastanum] Length = 405 Score = 134 bits (337), Expect = 3e-29 Identities = 65/109 (59%), Positives = 83/109 (76%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVYDDL K G PNAATFRT++F+ CK R+ YK+FK SVKV KIPDF+TLK+ Sbjct: 294 DEAQKVYDDLEK-NGCNPNAATFRTLIFYLCKKGRFETGYKVFKESVKVQKIPDFDTLKY 352 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEE 183 LV GL K +L +AKGM RT+ KKFPP L+K+W ++ EELG+A+ A + Sbjct: 353 LVEGLAKKSKLKDAKGMCRTVKKKFPPNLIKAWTKIEEELGLAKAEAPD 401 >ref|XP_006363148.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Solanum tuberosum] Length = 406 Score = 132 bits (332), Expect = 1e-28 Identities = 66/109 (60%), Positives = 81/109 (74%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVYDDL K R PNAATF+T++F+ CK R+ YK+FK SVKV KIPDFNTLK+ Sbjct: 295 DEAQKVYDDLEKNR-CNPNAATFKTLIFYLCKKGRFETGYKVFKESVKVQKIPDFNTLKY 353 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEE 183 LV GL K L +AKGM RT+ KKFPP L+K W +L EELG+A+ A + Sbjct: 354 LVEGLVKKSMLKDAKGMSRTVKKKFPPNLVKDWTKLEEELGLAKAEAPD 402 >ref|XP_009795026.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] gi|698498219|ref|XP_009795027.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] gi|698498221|ref|XP_009795028.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] gi|698498223|ref|XP_009795029.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] gi|698498226|ref|XP_009795030.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] gi|698498228|ref|XP_009795031.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] gi|698498230|ref|XP_009795032.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] gi|698498233|ref|XP_009795033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] gi|698498235|ref|XP_009795034.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] Length = 409 Score = 130 bits (328), Expect = 3e-28 Identities = 63/107 (58%), Positives = 84/107 (78%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+DL ++G PNAATFRT++F+ CK R+ YK+FK SV+V KIPDF+TLK+ Sbjct: 289 DEAQKVYEDL-GSKGCNPNAATFRTLIFYLCKKGRFETGYKVFKESVRVHKIPDFSTLKY 347 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAA 189 LV GL + +L +AKGM RT+ KKFPP L+K+W +L EELG+A+L A Sbjct: 348 LVEGLVQRSKLKDAKGMGRTVKKKFPPNLVKAWTKLEEELGLAKLEA 394 >ref|XP_009626271.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana tomentosiformis] gi|697144313|ref|XP_009626272.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana tomentosiformis] Length = 409 Score = 130 bits (326), Expect = 5e-28 Identities = 62/107 (57%), Positives = 84/107 (78%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+DL +++G PNAATFRT++F+ CK R+ Y +FK SV+V KIPDF+TLK+ Sbjct: 289 DEAQKVYEDL-ESKGCNPNAATFRTLIFYLCKKGRFETGYTVFKESVRVHKIPDFSTLKY 347 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAA 189 LV GL + +L +AKGM RT+ KKFPP L+K+W +L EELG+A+L A Sbjct: 348 LVEGLVQRSKLKDAKGMSRTVKKKFPPNLVKAWTKLEEELGLAKLEA 394 >ref|XP_004232380.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Solanum lycopersicum] Length = 405 Score = 129 bits (325), Expect = 7e-28 Identities = 64/109 (58%), Positives = 81/109 (74%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+ VYDDL K G PNAATFRT++F+ CK RY YK+FK SVKV KIPDF+TL + Sbjct: 294 DEAQMVYDDLEK-NGCNPNAATFRTLIFYLCKKGRYETGYKVFKESVKVQKIPDFDTLTY 352 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEE 183 LV GL K +L +AKGM RT+ KKFPP L+K+W +L +ELG+A+ A + Sbjct: 353 LVEGLVKKSKLKDAKGMSRTVKKKFPPNLVKAWTKLEKELGLAKAEAPD 401 >gb|ABU45173.1| unknown [Solanum melongena] Length = 427 Score = 127 bits (320), Expect = 3e-27 Identities = 66/125 (52%), Positives = 88/125 (70%), Gaps = 3/125 (2%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+DL K G PNAATFRT++F+ CK R+ YK+F+ SV V KIPDF TLK+ Sbjct: 292 DEAQKVYEDL-KTNGCNPNAATFRTLIFYLCKKGRFETGYKVFRESVSVHKIPDFITLKY 350 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEE---VDTSEVVN 159 LV GL K R +AKGM RT+ KKFPP L+K+W +L E+LG+A++ A + V+ S+ Sbjct: 351 LVEGLVKKSRWRDAKGMSRTVKKKFPPNLVKAWIKLEEDLGLAKVEASDNAKVEASDNAK 410 Query: 158 GASSD 144 +SD Sbjct: 411 VEASD 415 >gb|ABU45192.1| unknown [Petunia integrifolia subsp. inflata] Length = 406 Score = 126 bits (317), Expect = 6e-27 Identities = 61/110 (55%), Positives = 82/110 (74%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+DL + G PNAATFR+++ + CK R+ YK+FK SV+V K+PDFNTLK Sbjct: 292 DEAQKVYEDL-ETNGCNPNAATFRSLILYLCKKGRFETGYKVFKESVRVNKMPDFNTLKC 350 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEV 180 LV GL K +L +AKGM RT+ KKFPP L+K+W +L EELG+A++ +V Sbjct: 351 LVEGLVKREKLKDAKGMSRTVKKKFPPNLVKAWAKLEEELGLAKVEVGDV 400 >ref|XP_004233512.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Solanum lycopersicum] Length = 416 Score = 125 bits (315), Expect = 1e-26 Identities = 58/114 (50%), Positives = 85/114 (74%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEAEKVY+DL + +G PNA+TFRT++F+ CK E++ YK+F+ SV+ KIPD NTLK+ Sbjct: 299 DEAEKVYEDL-ETKGCNPNASTFRTLIFYLCKNEQFETGYKVFRESVRANKIPDVNTLKY 357 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSE 168 LV GL K+ + EAK M+RTM KKFP ++K W ++ EELG+A++ ++ ++E Sbjct: 358 LVHGLAKSSKAKEAKEMIRTMKKKFPANVVKVWTKIEEELGLAKVELGDIKSNE 411 >ref|XP_011654338.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Cucumis sativus] Length = 418 Score = 122 bits (306), Expect = 1e-25 Identities = 58/114 (50%), Positives = 84/114 (73%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+D+ + G NAATFRT+++H C+ Y + YK+FK SVK+ KIPDFNTLK+ Sbjct: 301 DEAKKVYNDM-EINGCNKNAATFRTLIYHLCRNGEYEKGYKVFKESVKMNKIPDFNTLKY 359 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSE 168 LV GL + + EAKG++RT+ KKFPP+ LK+W E+ E +G+A A ++V + + Sbjct: 360 LVEGLVEKKMMREAKGLIRTIRKKFPPDTLKAWREVEEGVGLAS-AGDDVSSKD 412 >gb|KGN53262.1| hypothetical protein Csa_4G038790 [Cucumis sativus] Length = 445 Score = 122 bits (306), Expect = 1e-25 Identities = 58/114 (50%), Positives = 84/114 (73%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+D+ + G NAATFRT+++H C+ Y + YK+FK SVK+ KIPDFNTLK+ Sbjct: 328 DEAKKVYNDM-EINGCNKNAATFRTLIYHLCRNGEYEKGYKVFKESVKMNKIPDFNTLKY 386 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSE 168 LV GL + + EAKG++RT+ KKFPP+ LK+W E+ E +G+A A ++V + + Sbjct: 387 LVEGLVEKKMMREAKGLIRTIRKKFPPDTLKAWREVEEGVGLAS-AGDDVSSKD 439 >ref|XP_007046988.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508699249|gb|EOX91145.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 411 Score = 122 bits (305), Expect = 1e-25 Identities = 58/102 (56%), Positives = 77/102 (75%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+ L + G PNAATFRT+VF+ C + + YK+FK SV++ KIPDFNTLKH Sbjct: 293 DEAKKVYEGL-EGNGCNPNAATFRTLVFYLCLNGLHEQGYKVFKESVRLHKIPDFNTLKH 351 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGV 204 LV GL K ++ EAKG++RT+ KKFPP L +W++L EELG+ Sbjct: 352 LVEGLVKNKKIKEAKGLIRTVKKKFPPNFLNAWKKLEEELGL 393 >gb|ABU45188.1| unknown [Capsicum frutescens] Length = 373 Score = 122 bits (305), Expect = 1e-25 Identities = 59/105 (56%), Positives = 79/105 (75%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 +E +KVY+DL +A G PNAATFRT++F+ K +Y YK+FK SV+V KIPDFNTL++ Sbjct: 257 NEVQKVYEDL-EANGCNPNAATFRTLIFYLSKKGKYEAGYKVFKESVRVNKIPDFNTLEY 315 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARL 195 LV GL K +L EAK M +T+ KKFPP L+K+W +L EELG+A + Sbjct: 316 LVEGLVKRSKLNEAKRMSKTVKKKFPPNLVKAWTKLEEELGLAEV 360 >ref|XP_012436918.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Gossypium raimondii] gi|763781351|gb|KJB48422.1| hypothetical protein B456_008G068700 [Gossypium raimondii] Length = 408 Score = 121 bits (304), Expect = 2e-25 Identities = 60/114 (52%), Positives = 80/114 (70%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+ L + G PNAATFRT+VF+ C Y + YK+FK SV++ KIPDFNTLKH Sbjct: 293 DEAKKVYEGL-EGNGCNPNAATFRTLVFYLCLNGLYEQGYKVFKESVRLHKIPDFNTLKH 351 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSE 168 LV GL ++ +AKG++RT+ K FPP LK+W++L EELG+ AE + E Sbjct: 352 LVEGLVMKKKIKDAKGLIRTVKKTFPPNFLKAWKKLEEELGLVSGNAEAREAKE 405 >ref|XP_009627584.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana tomentosiformis] Length = 407 Score = 121 bits (304), Expect = 2e-25 Identities = 57/114 (50%), Positives = 81/114 (71%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEAEKVY+DL + G PNA+TFRT++F+ C+ ER+ Y++F+ SV KIPD NTLK+ Sbjct: 291 DEAEKVYEDL-ETNGCNPNASTFRTLIFYLCRSERFEAGYRVFRESVTANKIPDVNTLKY 349 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSE 168 LV GL K+ + +AK M+RTM KKFPP ++K W +L ELG+A+ + ++E Sbjct: 350 LVHGLVKSSKAKDAKEMIRTMKKKFPPNVVKVWIKLEHELGLAKAEDSGIKSNE 403 >ref|XP_008453729.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Cucumis melo] Length = 423 Score = 121 bits (304), Expect = 2e-25 Identities = 58/114 (50%), Positives = 83/114 (72%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 DEA+KVY+D+ + G NAATFRT ++H C+ Y + YK+FK SVK+ KIPDFNTLK+ Sbjct: 299 DEAKKVYNDM-EINGCNKNAATFRTFIYHLCRNGEYEKGYKVFKESVKMNKIPDFNTLKY 357 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSE 168 LV GL + + EAKG++RT+ KKFPP+ LK+W E+ E +G+A A ++V + + Sbjct: 358 LVEGLVEKKMMREAKGLIRTVRKKFPPDTLKAWREVEEGVGLAS-AGDDVSSKD 410 >ref|XP_008338124.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Malus domestica] Length = 405 Score = 121 bits (304), Expect = 2e-25 Identities = 60/117 (51%), Positives = 85/117 (72%) Frame = -2 Query: 509 DEAEKVYDDLLKARGVRPNAATFRTMVFHSCKVERYVRAYKIFKMSVKVGKIPDFNTLKH 330 +EA KVY+ L + PNAATFRT++F+ CK E Y +AY++FK SV+V KIPDFNT+K+ Sbjct: 285 EEAFKVYEGL-EGNACNPNAATFRTLIFYLCKSEDYDKAYEVFKRSVEVHKIPDFNTMKY 343 Query: 329 LVTGLTKTGRLVEAKGMVRTMNKKFPPELLKSWEELAEELGVARLAAEEVDTSEVVN 159 LV GL K ++ EAKG++RT+ KKFPP +L +W++L + LG LA+ + D S V + Sbjct: 344 LVEGLVKKKKMKEAKGLIRTIKKKFPPNVLVAWKKLEQGLG---LASSDTDASSVTD 397