BLASTX nr result
ID: Perilla23_contig00003479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00003479 (313 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35669.1| hypothetical protein MIMGU_mgv1a015417mg [Erythra... 59 1e-06 gb|EYU35668.1| hypothetical protein MIMGU_mgv1a015413mg [Erythra... 58 3e-06 >gb|EYU35669.1| hypothetical protein MIMGU_mgv1a015417mg [Erythranthe guttata] Length = 158 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = +3 Query: 3 GQGTTNVNGIFNISVPNLVQTLGNVITLNPLIPCTVSIPLPLKETACPIINMTRGAL--- 173 G G TNVNG FNI+VP + G ++ L P++PC V++ LPL CP++N T G L Sbjct: 75 GSGITNVNGSFNITVPAIT---GLILGL-PMLPCVVTVQLPLSPVVCPVLNATTGILAAT 130 Query: 174 -NGIPSILT 197 N I ++LT Sbjct: 131 VNSIGTVLT 139 >gb|EYU35668.1| hypothetical protein MIMGU_mgv1a015413mg [Erythranthe guttata] Length = 158 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/74 (40%), Positives = 42/74 (56%) Frame = +3 Query: 3 GQGTTNVNGIFNISVPNLVQTLGNVITLNPLIPCTVSIPLPLKETACPIINMTRGALNGI 182 G G TNVNG FNI+VP + G ++ L P++PC V++ LPL CP+IN T G L Sbjct: 75 GSGITNVNGSFNITVPAIT---GLILGL-PMLPCVVTVQLPLSPVVCPVINATTGILAAT 130 Query: 183 PSILTDVTQGVSGL 224 + + + GL Sbjct: 131 VNSVGTLVNSTLGL 144