BLASTX nr result
ID: Perilla23_contig00003124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00003124 (460 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831561.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 86 8e-15 ref|XP_011079996.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 81 3e-13 gb|EYU46501.1| hypothetical protein MIMGU_mgv1a006955mg [Erythra... 81 3e-13 gb|EPS67894.1| hypothetical protein M569_06878, partial [Genlise... 79 1e-12 ref|XP_011082612.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 73 9e-11 gb|EPS62332.1| hypothetical protein M569_12460, partial [Genlise... 73 9e-11 ref|XP_012829052.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 72 2e-10 ref|XP_010100087.1| E3 ubiquitin protein ligase DRIP2 [Morus not... 68 2e-09 ref|XP_009793324.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 68 3e-09 emb|CDP03700.1| unnamed protein product [Coffea canephora] 67 4e-09 ref|XP_009595328.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 67 7e-09 ref|XP_006351631.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 67 7e-09 ref|XP_007201897.1| hypothetical protein PRUPE_ppa007993mg [Prun... 67 7e-09 ref|XP_006352752.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 66 9e-09 ref|XP_004242351.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 66 9e-09 ref|XP_002275598.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 66 9e-09 ref|XP_009774801.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 66 1e-08 gb|KJB80574.1| hypothetical protein B456_013G104800 [Gossypium r... 65 1e-08 gb|KJB80573.1| hypothetical protein B456_013G104800 [Gossypium r... 65 1e-08 ref|XP_012464022.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 65 1e-08 >ref|XP_012831561.1| PREDICTED: E3 ubiquitin protein ligase DRIP2 [Erythranthe guttatus] Length = 447 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 128 ELVNTMSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 +L NTMSHQVV+VRREAVAPCMTCPLCHKLFRDATTIIECLH Sbjct: 19 KLDNTMSHQVVKVRREAVAPCMTCPLCHKLFRDATTIIECLH 60 >ref|XP_011079996.1| PREDICTED: E3 ubiquitin protein ligase DRIP2 [Sesamum indicum] Length = 427 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MSHQVV+VRREAVAPCMTCPLCHKLFRDATTIIECLH Sbjct: 1 MSHQVVKVRREAVAPCMTCPLCHKLFRDATTIIECLH 37 >gb|EYU46501.1| hypothetical protein MIMGU_mgv1a006955mg [Erythranthe guttata] Length = 424 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MSHQVV+VRREAVAPCMTCPLCHKLFRDATTIIECLH Sbjct: 1 MSHQVVKVRREAVAPCMTCPLCHKLFRDATTIIECLH 37 >gb|EPS67894.1| hypothetical protein M569_06878, partial [Genlisea aurea] Length = 422 Score = 79.3 bits (194), Expect = 1e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MSHQVV V+REAVAPCMTCPLCHKLFRDATTIIECLH Sbjct: 1 MSHQVVTVKREAVAPCMTCPLCHKLFRDATTIIECLH 37 >ref|XP_011082612.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Sesamum indicum] gi|747071485|ref|XP_011082614.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Sesamum indicum] Length = 426 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 101 VVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 VV+VRREAVAPCMTCPLCHKLFRDATTIIECLH Sbjct: 7 VVKVRREAVAPCMTCPLCHKLFRDATTIIECLH 39 >gb|EPS62332.1| hypothetical protein M569_12460, partial [Genlisea aurea] Length = 92 Score = 72.8 bits (177), Expect = 9e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MSHQV+ ++R+AVAPCMTCPLC KLFRDATTIIECLH Sbjct: 5 MSHQVLNLKRKAVAPCMTCPLCRKLFRDATTIIECLH 41 >ref|XP_012829052.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Erythranthe guttatus] gi|848932335|ref|XP_012829053.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Erythranthe guttatus] gi|604297779|gb|EYU17898.1| hypothetical protein MIMGU_mgv1a007427mg [Erythranthe guttata] Length = 408 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MSHQ V+VRREAV PCMTC LCHKL RDATTIIECLH Sbjct: 1 MSHQTVKVRREAVVPCMTCLLCHKLLRDATTIIECLH 37 >ref|XP_010100087.1| E3 ubiquitin protein ligase DRIP2 [Morus notabilis] gi|587892752|gb|EXB81323.1| E3 ubiquitin protein ligase DRIP2 [Morus notabilis] Length = 432 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 M++QVV+VRRE + CMTCPLCHKLFRDATTI ECLH Sbjct: 1 MANQVVKVRRETIEACMTCPLCHKLFRDATTISECLH 37 >ref|XP_009793324.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Nicotiana sylvestris] Length = 430 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MS+QVV VRR+ + CMTCPLCHKLFRDATTI ECLH Sbjct: 1 MSNQVVNVRRDRIGACMTCPLCHKLFRDATTISECLH 37 >emb|CDP03700.1| unnamed protein product [Coffea canephora] Length = 428 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MS+QVV+V+RE +A CMTCPLC+KLFRDATTI ECLH Sbjct: 1 MSNQVVKVKRETIAACMTCPLCNKLFRDATTISECLH 37 >ref|XP_009595328.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Nicotiana tomentosiformis] Length = 430 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MS+Q V+VRR+ + CMTCPLCHKLFRDATTI ECLH Sbjct: 1 MSNQAVKVRRDRIGACMTCPLCHKLFRDATTISECLH 37 >ref|XP_006351631.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Solanum tuberosum] Length = 430 Score = 66.6 bits (161), Expect = 7e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 M++Q+V+V+R+ +A CMTCPLCHKLFRDATTI ECLH Sbjct: 1 MTNQLVKVKRDVIAACMTCPLCHKLFRDATTISECLH 37 >ref|XP_007201897.1| hypothetical protein PRUPE_ppa007993mg [Prunus persica] gi|462397297|gb|EMJ03096.1| hypothetical protein PRUPE_ppa007993mg [Prunus persica] Length = 349 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 M +QVV+V+RE + CMTCPLCHKLFRDATTI ECLH Sbjct: 1 MPNQVVKVKRETITACMTCPLCHKLFRDATTISECLH 37 >ref|XP_006352752.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Solanum tuberosum] Length = 433 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 M +QVV+V+RE +A C+TCPLCHKLFRDATTI ECLH Sbjct: 1 MPNQVVKVKREKIAACITCPLCHKLFRDATTISECLH 37 >ref|XP_004242351.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Solanum lycopersicum] Length = 431 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 M +QVV+V+RE +A C+TCPLCHKLFRDATTI ECLH Sbjct: 1 MPNQVVKVKRERIAACITCPLCHKLFRDATTISECLH 37 >ref|XP_002275598.1| PREDICTED: E3 ubiquitin protein ligase DRIP2 [Vitis vinifera] gi|731394749|ref|XP_010651942.1| PREDICTED: E3 ubiquitin protein ligase DRIP2 [Vitis vinifera] gi|297735508|emb|CBI17948.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 MS+QVV+VRRE +A CMTCPLC+KL RDATTI ECLH Sbjct: 1 MSNQVVKVRRETIAACMTCPLCNKLLRDATTISECLH 37 >ref|XP_009774801.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Nicotiana sylvestris] Length = 435 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 122 VNTMSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 + M++QVV+V+R+ +A C+TCPLCHKLFRDATT+ ECLH Sbjct: 1 MRNMANQVVKVKRDRIAACITCPLCHKLFRDATTVSECLH 40 >gb|KJB80574.1| hypothetical protein B456_013G104800 [Gossypium raimondii] Length = 331 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 M++QVV+V+REA+A CMTCPLC+KL RDATTI ECLH Sbjct: 1 MANQVVKVKREAIAACMTCPLCNKLLRDATTISECLH 37 >gb|KJB80573.1| hypothetical protein B456_013G104800 [Gossypium raimondii] Length = 385 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 M++QVV+V+REA+A CMTCPLC+KL RDATTI ECLH Sbjct: 1 MANQVVKVKREAIAACMTCPLCNKLLRDATTISECLH 37 >ref|XP_012464022.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Gossypium raimondii] gi|823262538|ref|XP_012464023.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Gossypium raimondii] gi|763813720|gb|KJB80572.1| hypothetical protein B456_013G104800 [Gossypium raimondii] Length = 429 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 113 MSHQVVEVRREAVAPCMTCPLCHKLFRDATTIIECLH 3 M++QVV+V+REA+A CMTCPLC+KL RDATTI ECLH Sbjct: 1 MANQVVKVKREAIAACMTCPLCNKLLRDATTISECLH 37