BLASTX nr result
ID: Perilla23_contig00002901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00002901 (577 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097593.1| PREDICTED: ethylene-responsive transcription... 71 3e-10 ref|XP_012853381.1| PREDICTED: ethylene-responsive transcription... 46 2e-08 >ref|XP_011097593.1| PREDICTED: ethylene-responsive transcription factor RAP2-4 [Sesamum indicum] Length = 369 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 244 NLYAGFGSIPSRTQVISPGFPSFSQMVNEQTVGTIGLNQLTPS 116 N+Y GF S+PSRTQ+ SPGF SFSQ+ +EQTV TIGLNQLTPS Sbjct: 73 NMYTGFSSVPSRTQIFSPGFSSFSQLGDEQTVSTIGLNQLTPS 115 >ref|XP_012853381.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like [Erythranthe guttatus] gi|604304755|gb|EYU24006.1| hypothetical protein MIMGU_mgv1a009524mg [Erythranthe guttata] Length = 339 Score = 46.2 bits (108), Expect(2) = 2e-08 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -1 Query: 247 NNLY-AGFGSIPSRTQVISPGFPSFSQMV-NEQTVGTIGLNQLTPS 116 +NLY FGS+P + Q+ SPGF +F Q+V N Q I LN LTPS Sbjct: 66 SNLYNTEFGSLPQKAQIFSPGFSNFPQIVDNHQPANQINLNHLTPS 111 Score = 39.3 bits (90), Expect(2) = 2e-08 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 3/28 (10%) Frame = -2 Query: 420 MAAAIDMYGSNS---FSSDPLREELMQA 346 MAAAID+YG N+ FS+DP REELMQA Sbjct: 1 MAAAIDIYGCNNNQAFSTDPFREELMQA 28