BLASTX nr result
ID: Perilla23_contig00001363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00001363 (425 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102946.1| Serine/threonine-protein kinase AFC2 [Morus ... 69 1e-09 ref|XP_012829294.1| PREDICTED: serine/threonine-protein kinase A... 67 5e-09 ref|XP_011101274.1| PREDICTED: serine/threonine-protein kinase A... 67 5e-09 ref|XP_011101273.1| PREDICTED: serine/threonine-protein kinase A... 67 5e-09 gb|EYU17757.1| hypothetical protein MIMGU_mgv1a006818mg [Erythra... 67 5e-09 ref|XP_012829293.1| PREDICTED: serine/threonine-protein kinase A... 67 5e-09 gb|EYU17755.1| hypothetical protein MIMGU_mgv1a006818mg [Erythra... 67 5e-09 ref|XP_002511301.1| afc, putative [Ricinus communis] gi|22355041... 67 7e-09 gb|KDO69456.1| hypothetical protein CISIN_1g0139731mg [Citrus si... 65 2e-08 gb|KDO69454.1| hypothetical protein CISIN_1g0139731mg [Citrus si... 65 2e-08 gb|KDO69452.1| hypothetical protein CISIN_1g0139731mg, partial [... 65 2e-08 ref|XP_006439955.1| hypothetical protein CICLE_v10020223mg [Citr... 65 2e-08 ref|XP_006439954.1| hypothetical protein CICLE_v10020223mg [Citr... 65 2e-08 ref|XP_006439953.1| hypothetical protein CICLE_v10020223mg [Citr... 65 2e-08 ref|XP_006439952.1| hypothetical protein CICLE_v10020223mg [Citr... 65 2e-08 ref|XP_008239352.1| PREDICTED: serine/threonine-protein kinase A... 65 2e-08 ref|XP_008239351.1| PREDICTED: serine/threonine-protein kinase A... 65 2e-08 ref|XP_007209157.1| hypothetical protein PRUPE_ppa005990mg [Prun... 65 2e-08 ref|XP_010663081.1| PREDICTED: serine/threonine-protein kinase A... 65 3e-08 ref|XP_010027174.1| PREDICTED: serine/threonine-protein kinase A... 65 3e-08 >ref|XP_010102946.1| Serine/threonine-protein kinase AFC2 [Morus notabilis] gi|587906392|gb|EXB94464.1| Serine/threonine-protein kinase AFC2 [Morus notabilis] Length = 903 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRRY 314 DLIHLLQGLLKYDPSDR++A EAL HPFF++DHLRRY Sbjct: 382 DLIHLLQGLLKYDPSDRLTACEALRHPFFSRDHLRRY 418 >ref|XP_012829294.1| PREDICTED: serine/threonine-protein kinase AFC2 isoform X2 [Erythranthe guttatus] Length = 330 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRRY 314 DLIHLLQGLL+YDPS+RMSA EAL H FFT+DH RRY Sbjct: 294 DLIHLLQGLLRYDPSERMSADEALKHSFFTRDHFRRY 330 >ref|XP_011101274.1| PREDICTED: serine/threonine-protein kinase AFC2 isoform X2 [Sesamum indicum] Length = 341 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DLIHLLQGLL+YDP++R+SA+EAL HPFFT+DHLRR Sbjct: 305 DLIHLLQGLLRYDPAERLSAKEALRHPFFTRDHLRR 340 >ref|XP_011101273.1| PREDICTED: serine/threonine-protein kinase AFC2 isoform X1 [Sesamum indicum] Length = 426 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DLIHLLQGLL+YDP++R+SA+EAL HPFFT+DHLRR Sbjct: 390 DLIHLLQGLLRYDPAERLSAKEALRHPFFTRDHLRR 425 >gb|EYU17757.1| hypothetical protein MIMGU_mgv1a006818mg [Erythranthe guttata] Length = 347 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRRY 314 DLIHLLQGLL+YDPS+RMSA EAL H FFT+DH RRY Sbjct: 311 DLIHLLQGLLRYDPSERMSADEALKHSFFTRDHFRRY 347 >ref|XP_012829293.1| PREDICTED: serine/threonine-protein kinase AFC2 isoform X1 [Erythranthe guttatus] gi|604297543|gb|EYU17756.1| hypothetical protein MIMGU_mgv1a006818mg [Erythranthe guttata] Length = 429 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRRY 314 DLIHLLQGLL+YDPS+RMSA EAL H FFT+DH RRY Sbjct: 393 DLIHLLQGLLRYDPSERMSADEALKHSFFTRDHFRRY 429 >gb|EYU17755.1| hypothetical protein MIMGU_mgv1a006818mg [Erythranthe guttata] Length = 430 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRRY 314 DLIHLLQGLL+YDPS+RMSA EAL H FFT+DH RRY Sbjct: 394 DLIHLLQGLLRYDPSERMSADEALKHSFFTRDHFRRY 430 >ref|XP_002511301.1| afc, putative [Ricinus communis] gi|223550416|gb|EEF51903.1| afc, putative [Ricinus communis] Length = 435 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DLIHLLQGLL+YDPSDR++A+EAL HPFF +DHLRR Sbjct: 400 DLIHLLQGLLRYDPSDRLTAREALRHPFFARDHLRR 435 >gb|KDO69456.1| hypothetical protein CISIN_1g0139731mg [Citrus sinensis] Length = 252 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DL HLLQGLL+YDP+DR++A+EAL HPFFT+DHLRR Sbjct: 217 DLTHLLQGLLRYDPTDRLTAREALRHPFFTRDHLRR 252 >gb|KDO69454.1| hypothetical protein CISIN_1g0139731mg [Citrus sinensis] Length = 379 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DL HLLQGLL+YDP+DR++A+EAL HPFFT+DHLRR Sbjct: 344 DLTHLLQGLLRYDPTDRLTAREALRHPFFTRDHLRR 379 >gb|KDO69452.1| hypothetical protein CISIN_1g0139731mg, partial [Citrus sinensis] gi|641850581|gb|KDO69453.1| hypothetical protein CISIN_1g0139731mg, partial [Citrus sinensis] Length = 400 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DL HLLQGLL+YDP+DR++A+EAL HPFFT+DHLRR Sbjct: 365 DLTHLLQGLLRYDPTDRLTAREALRHPFFTRDHLRR 400 >ref|XP_006439955.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|557542217|gb|ESR53195.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] Length = 338 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DL HLLQGLL+YDP+DR++A+EAL HPFFT+DHLRR Sbjct: 303 DLTHLLQGLLRYDPTDRLTAREALRHPFFTRDHLRR 338 >ref|XP_006439954.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|557542216|gb|ESR53194.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] Length = 430 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DL HLLQGLL+YDP+DR++A+EAL HPFFT+DHLRR Sbjct: 395 DLTHLLQGLLRYDPTDRLTAREALRHPFFTRDHLRR 430 >ref|XP_006439953.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|557542215|gb|ESR53193.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] Length = 433 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DL HLLQGLL+YDP+DR++A+EAL HPFFT+DHLRR Sbjct: 398 DLTHLLQGLLRYDPTDRLTAREALRHPFFTRDHLRR 433 >ref|XP_006439952.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|557542214|gb|ESR53192.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|641850583|gb|KDO69455.1| hypothetical protein CISIN_1g0139731mg [Citrus sinensis] Length = 329 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DL HLLQGLL+YDP+DR++A+EAL HPFFT+DHLRR Sbjct: 294 DLTHLLQGLLRYDPTDRLTAREALRHPFFTRDHLRR 329 >ref|XP_008239352.1| PREDICTED: serine/threonine-protein kinase AFC2 isoform X2 [Prunus mume] Length = 330 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DLIHLLQGLL+YDPSDR+SA+EAL H FFTKD+LRR Sbjct: 295 DLIHLLQGLLRYDPSDRLSAREALRHSFFTKDNLRR 330 >ref|XP_008239351.1| PREDICTED: serine/threonine-protein kinase AFC2 isoform X1 [Prunus mume] Length = 433 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DLIHLLQGLL+YDPSDR+SA+EAL H FFTKD+LRR Sbjct: 398 DLIHLLQGLLRYDPSDRLSAREALRHSFFTKDNLRR 433 >ref|XP_007209157.1| hypothetical protein PRUPE_ppa005990mg [Prunus persica] gi|462404892|gb|EMJ10356.1| hypothetical protein PRUPE_ppa005990mg [Prunus persica] Length = 433 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DLIHLLQGLL+YDPSDR+SA+EAL H FFTKD+LRR Sbjct: 398 DLIHLLQGLLRYDPSDRLSAREALRHSFFTKDNLRR 433 >ref|XP_010663081.1| PREDICTED: serine/threonine-protein kinase AFC2 isoform X2 [Vitis vinifera] Length = 345 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DLIHLLQGLL+YDPSDR++A AL HPFFT+DHLRR Sbjct: 309 DLIHLLQGLLRYDPSDRLTALGALRHPFFTRDHLRR 344 >ref|XP_010027174.1| PREDICTED: serine/threonine-protein kinase AFC2 isoform X2 [Eucalyptus grandis] Length = 329 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 424 DLIHLLQGLLKYDPSDRMSAQEALCHPFFTKDHLRR 317 DLIHLLQGLL+Y+P DR++A+EAL HPFFT+DHLRR Sbjct: 294 DLIHLLQGLLRYEPLDRLTAREALRHPFFTRDHLRR 329