BLASTX nr result
ID: Perilla23_contig00001234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00001234 (339 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086855.1| PREDICTED: EKC/KEOPS complex subunit bud32 [... 62 1e-07 ref|XP_012833234.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 59 1e-06 ref|XP_009760169.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 58 3e-06 ref|XP_009760168.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 58 3e-06 ref|XP_009612523.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 57 7e-06 ref|XP_008235382.1| PREDICTED: EKC/KEOPS complex subunit bud32 [... 57 7e-06 >ref|XP_011086855.1| PREDICTED: EKC/KEOPS complex subunit bud32 [Sesamum indicum] gi|747079321|ref|XP_011086856.1| PREDICTED: EKC/KEOPS complex subunit bud32 [Sesamum indicum] gi|747079323|ref|XP_011086857.1| PREDICTED: EKC/KEOPS complex subunit bud32 [Sesamum indicum] Length = 226 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 242 MEMKLDGIEGSLVLIKQGAEARVFESTFVGRR 337 ME+KLDG+EGSLVLIKQGAEARVFESTFVGRR Sbjct: 1 MEIKLDGVEGSLVLIKQGAEARVFESTFVGRR 32 >ref|XP_012833234.1| PREDICTED: EKC/KEOPS complex subunit bud32-like [Erythranthe guttatus] gi|604341656|gb|EYU40902.1| hypothetical protein MIMGU_mgv1a013249mg [Erythranthe guttata] Length = 226 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 242 MEMKLDGIEGSLVLIKQGAEARVFESTFVGRR 337 MEMKLDG EGS+VLIKQGAEARVFESTFVG+R Sbjct: 1 MEMKLDGEEGSVVLIKQGAEARVFESTFVGKR 32 >ref|XP_009760169.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X2 [Nicotiana sylvestris] Length = 226 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 242 MEMKLDGIEGSLVLIKQGAEARVFESTFVGRR 337 ME+K DG +GSLVLIKQGAEARVFESTFVGRR Sbjct: 1 MELKADGSDGSLVLIKQGAEARVFESTFVGRR 32 >ref|XP_009760168.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana sylvestris] Length = 271 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 242 MEMKLDGIEGSLVLIKQGAEARVFESTFVGRR 337 ME+K DG +GSLVLIKQGAEARVFESTFVGRR Sbjct: 46 MELKADGSDGSLVLIKQGAEARVFESTFVGRR 77 >ref|XP_009612523.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tomentosiformis] gi|697117190|ref|XP_009612524.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tomentosiformis] gi|697117192|ref|XP_009612525.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tomentosiformis] gi|697117194|ref|XP_009612526.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tomentosiformis] Length = 226 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 242 MEMKLDGIEGSLVLIKQGAEARVFESTFVGRR 337 ME+K DG +GSLVLIKQGAEARVFESTF+GRR Sbjct: 1 MEIKADGCDGSLVLIKQGAEARVFESTFLGRR 32 >ref|XP_008235382.1| PREDICTED: EKC/KEOPS complex subunit bud32 [Prunus mume] Length = 228 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 242 MEMKLDGIEGSLVLIKQGAEARVFESTFVGRR 337 ME K DG++GSL+LIKQGAEARVFES+FVGRR Sbjct: 1 METKADGVDGSLILIKQGAEARVFESSFVGRR 32