BLASTX nr result
ID: Perilla23_contig00001027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00001027 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73775.1| hypothetical protein M569_00979 [Genlisea aurea] 103 4e-20 ref|XP_009804049.1| PREDICTED: cullin-3A-like [Nicotiana sylvest... 102 8e-20 ref|XP_009603836.1| PREDICTED: cullin-3A [Nicotiana tomentosifor... 102 8e-20 ref|XP_006366700.1| PREDICTED: cullin-3A-like [Solanum tuberosum] 102 8e-20 ref|XP_011075492.1| PREDICTED: cullin-3A-like [Sesamum indicum] 102 1e-19 ref|XP_012855284.1| PREDICTED: LOW QUALITY PROTEIN: cullin-3A-li... 101 2e-19 ref|XP_011075493.1| PREDICTED: cullin-3A-like [Sesamum indicum] ... 101 2e-19 ref|XP_011071007.1| PREDICTED: cullin-3A-like [Sesamum indicum] 101 2e-19 gb|EYU22430.1| hypothetical protein MIMGU_mgv1a022204mg [Erythra... 101 2e-19 ref|XP_004228381.1| PREDICTED: cullin-3A [Solanum lycopersicum] 101 2e-19 ref|XP_010044731.1| PREDICTED: cullin-3B [Eucalyptus grandis] gi... 100 3e-19 ref|XP_012837463.1| PREDICTED: cullin-3A-like [Erythranthe gutta... 100 4e-19 ref|XP_009341005.1| PREDICTED: cullin-3A-like [Pyrus x bretschne... 99 1e-18 ref|XP_008341566.1| PREDICTED: cullin-3A-like [Malus domestica] 99 1e-18 ref|XP_011021604.1| PREDICTED: cullin-3A [Populus euphratica] 98 2e-18 ref|XP_012067623.1| PREDICTED: cullin-3A [Jatropha curcas] gi|64... 98 2e-18 ref|XP_002315795.1| cullin family protein [Populus trichocarpa] ... 98 2e-18 ref|XP_008221637.1| PREDICTED: cullin-3A [Prunus mume] 98 3e-18 ref|XP_007225214.1| hypothetical protein PRUPE_ppa001991mg [Prun... 98 3e-18 ref|XP_014509391.1| PREDICTED: cullin-3A-like [Vigna radiata var... 97 5e-18 >gb|EPS73775.1| hypothetical protein M569_00979 [Genlisea aurea] Length = 734 Score = 103 bits (258), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSSGQKK+NFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSSGQKKKNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_009804049.1| PREDICTED: cullin-3A-like [Nicotiana sylvestris] Length = 734 Score = 102 bits (255), Expect = 8e-20 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSS QKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_009603836.1| PREDICTED: cullin-3A [Nicotiana tomentosiformis] Length = 734 Score = 102 bits (255), Expect = 8e-20 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSS QKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_006366700.1| PREDICTED: cullin-3A-like [Solanum tuberosum] Length = 734 Score = 102 bits (255), Expect = 8e-20 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSS QKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_011075492.1| PREDICTED: cullin-3A-like [Sesamum indicum] Length = 734 Score = 102 bits (254), Expect = 1e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MS GQKKRNFQIEAF+HKVVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSGGQKKRNFQIEAFRHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_012855284.1| PREDICTED: LOW QUALITY PROTEIN: cullin-3A-like [Erythranthe guttatus] Length = 734 Score = 101 bits (252), Expect = 2e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSSG KKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSSGHKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_011075493.1| PREDICTED: cullin-3A-like [Sesamum indicum] gi|747058315|ref|XP_011075494.1| PREDICTED: cullin-3A-like [Sesamum indicum] Length = 734 Score = 101 bits (252), Expect = 2e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSSG KKRNFQIEAFKHKVVVDPKYADKTW+ILEHAIHEIYNHNASGLS Sbjct: 1 MSSGPKKRNFQIEAFKHKVVVDPKYADKTWRILEHAIHEIYNHNASGLS 49 >ref|XP_011071007.1| PREDICTED: cullin-3A-like [Sesamum indicum] Length = 734 Score = 101 bits (252), Expect = 2e-19 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSSGQKKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIY+HNASGLS Sbjct: 1 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYSHNASGLS 49 >gb|EYU22430.1| hypothetical protein MIMGU_mgv1a022204mg [Erythranthe guttata] Length = 700 Score = 101 bits (252), Expect = 2e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSSG KKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSSGHKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_004228381.1| PREDICTED: cullin-3A [Solanum lycopersicum] Length = 734 Score = 101 bits (251), Expect = 2e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSS QKKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_010044731.1| PREDICTED: cullin-3B [Eucalyptus grandis] gi|629122344|gb|KCW86834.1| hypothetical protein EUGRSUZ_B03431 [Eucalyptus grandis] Length = 733 Score = 100 bits (250), Expect = 3e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MS+ QKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 1 MSNPQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 49 >ref|XP_012837463.1| PREDICTED: cullin-3A-like [Erythranthe guttatus] gi|604332994|gb|EYU37409.1| hypothetical protein MIMGU_mgv1a001957mg [Erythranthe guttata] Length = 734 Score = 100 bits (249), Expect = 4e-19 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 149 MSSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 MSSG KKRNFQIEAFKHKVVVDPKYA+KTWKIL+HAIHEIYNHNASGLS Sbjct: 1 MSSGHKKRNFQIEAFKHKVVVDPKYAEKTWKILDHAIHEIYNHNASGLS 49 >ref|XP_009341005.1| PREDICTED: cullin-3A-like [Pyrus x bretschneideri] Length = 733 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 143 SGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 SGQKKRNFQIEAFKH+VVVDPKYA+KTWKILEHAIHEIYNHNASGLS Sbjct: 2 SGQKKRNFQIEAFKHRVVVDPKYAEKTWKILEHAIHEIYNHNASGLS 48 >ref|XP_008341566.1| PREDICTED: cullin-3A-like [Malus domestica] Length = 733 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -1 Query: 143 SGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 SGQKKRNFQIEAFKH+VVVDPKYA+KTWKILEHAIHEIYNHNASGLS Sbjct: 2 SGQKKRNFQIEAFKHRVVVDPKYAEKTWKILEHAIHEIYNHNASGLS 48 >ref|XP_011021604.1| PREDICTED: cullin-3A [Populus euphratica] Length = 733 Score = 98.2 bits (243), Expect = 2e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 143 SGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 S QKKRNFQIEAFKH+VVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 2 SNQKKRNFQIEAFKHRVVVDPKYADKTWKILEHAIHEIYNHNASGLS 48 >ref|XP_012067623.1| PREDICTED: cullin-3A [Jatropha curcas] gi|643734513|gb|KDP41183.1| hypothetical protein JCGZ_15590 [Jatropha curcas] Length = 732 Score = 98.2 bits (243), Expect = 2e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 143 SGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 S QKKRNFQIEAFKH+VVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 2 SNQKKRNFQIEAFKHRVVVDPKYADKTWKILEHAIHEIYNHNASGLS 48 >ref|XP_002315795.1| cullin family protein [Populus trichocarpa] gi|222864835|gb|EEF01966.1| cullin family protein [Populus trichocarpa] Length = 733 Score = 98.2 bits (243), Expect = 2e-18 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -1 Query: 143 SGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 S QKKRNFQIEAFKH+VVVDPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 2 SNQKKRNFQIEAFKHRVVVDPKYADKTWKILEHAIHEIYNHNASGLS 48 >ref|XP_008221637.1| PREDICTED: cullin-3A [Prunus mume] Length = 732 Score = 97.8 bits (242), Expect = 3e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 SGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 S QKKRNFQIEAFKH+VVVDPKYADKTWK+LEHAIHEIYNHNASGLS Sbjct: 2 SNQKKRNFQIEAFKHRVVVDPKYADKTWKVLEHAIHEIYNHNASGLS 48 >ref|XP_007225214.1| hypothetical protein PRUPE_ppa001991mg [Prunus persica] gi|462422150|gb|EMJ26413.1| hypothetical protein PRUPE_ppa001991mg [Prunus persica] Length = 732 Score = 97.8 bits (242), Expect = 3e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 SGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 S QKKRNFQIEAFKH+VVVDPKYADKTWK+LEHAIHEIYNHNASGLS Sbjct: 2 SNQKKRNFQIEAFKHRVVVDPKYADKTWKVLEHAIHEIYNHNASGLS 48 >ref|XP_014509391.1| PREDICTED: cullin-3A-like [Vigna radiata var. radiata] Length = 732 Score = 97.1 bits (240), Expect = 5e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 143 SGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLS 3 S QKKRNFQIEAFKH+VV+DPKYADKTWKILEHAIHEIYNHNASGLS Sbjct: 2 SNQKKRNFQIEAFKHRVVMDPKYADKTWKILEHAIHEIYNHNASGLS 48