BLASTX nr result
ID: Perilla23_contig00000606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00000606 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014507459.1| PREDICTED: 40S ribosomal protein S15a-like [... 94 3e-17 ref|XP_014505890.1| PREDICTED: 40S ribosomal protein S15a [Vigna... 94 3e-17 gb|KOM33595.1| hypothetical protein LR48_Vigan01g315100 [Vigna a... 94 3e-17 gb|KMZ66359.1| putative 30S ribosomal protein S8 [Zostera marina] 94 3e-17 ref|XP_011073203.1| PREDICTED: 40S ribosomal protein S15a-like [... 94 3e-17 ref|XP_011094909.1| PREDICTED: 40S ribosomal protein S15a-like [... 94 3e-17 ref|XP_010937690.1| PREDICTED: 40S ribosomal protein S15a-like [... 94 3e-17 ref|XP_009419271.1| PREDICTED: 40S ribosomal protein S15a [Musa ... 94 3e-17 ref|XP_009403451.1| PREDICTED: 40S ribosomal protein S15a-like [... 94 3e-17 ref|XP_008788086.1| PREDICTED: 40S ribosomal protein S15a [Phoen... 94 3e-17 ref|XP_008776453.1| PREDICTED: 40S ribosomal protein S15a-like [... 94 3e-17 emb|CBI31713.3| unnamed protein product [Vitis vinifera] 94 3e-17 ref|XP_007154165.1| hypothetical protein PHAVU_003G095800g [Phas... 94 3e-17 ref|XP_007154598.1| hypothetical protein PHAVU_003G132300g [Phas... 94 3e-17 ref|XP_006826960.1| PREDICTED: 40S ribosomal protein S15a [Ambor... 94 3e-17 sp|Q9AT34.3|RS15A_DAUCA RecName: Full=40S ribosomal protein S15a... 94 3e-17 ref|XP_002279090.1| PREDICTED: 40S ribosomal protein S15a [Vitis... 94 3e-17 emb|CDP09021.1| unnamed protein product [Coffea canephora] 93 7e-17 gb|KMZ74179.1| putative 30S ribosomal protein S8 [Zostera marina... 93 9e-17 ref|XP_010920679.1| PREDICTED: 40S ribosomal protein S15a-like [... 93 9e-17 >ref|XP_014507459.1| PREDICTED: 40S ribosomal protein S15a-like [Vigna radiata var. radiata] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_014505890.1| PREDICTED: 40S ribosomal protein S15a [Vigna radiata var. radiata] gi|950996956|ref|XP_014505891.1| PREDICTED: 40S ribosomal protein S15a [Vigna radiata var. radiata] gi|950996958|ref|XP_014505892.1| PREDICTED: 40S ribosomal protein S15a [Vigna radiata var. radiata] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|KOM33595.1| hypothetical protein LR48_Vigan01g315100 [Vigna angularis] gi|920704469|gb|KOM47694.1| hypothetical protein LR48_Vigan07g139800 [Vigna angularis] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|KMZ66359.1| putative 30S ribosomal protein S8 [Zostera marina] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_011073203.1| PREDICTED: 40S ribosomal protein S15a-like [Sesamum indicum] gi|747084071|ref|XP_011089429.1| PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] gi|747084073|ref|XP_011089430.1| PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_011094909.1| PREDICTED: 40S ribosomal protein S15a-like [Sesamum indicum] Length = 252 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 209 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 252 >ref|XP_010937690.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] gi|743842030|ref|XP_010937692.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] gi|743842034|ref|XP_010937693.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] gi|743842038|ref|XP_010937694.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_009419271.1| PREDICTED: 40S ribosomal protein S15a [Musa acuminata subsp. malaccensis] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_009403451.1| PREDICTED: 40S ribosomal protein S15a-like [Musa acuminata subsp. malaccensis] gi|695042687|ref|XP_009409007.1| PREDICTED: 40S ribosomal protein S15a-like [Musa acuminata subsp. malaccensis] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_008788086.1| PREDICTED: 40S ribosomal protein S15a [Phoenix dactylifera] gi|672137950|ref|XP_008792714.1| PREDICTED: 40S ribosomal protein S15a [Phoenix dactylifera] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_008776453.1| PREDICTED: 40S ribosomal protein S15a-like [Phoenix dactylifera] gi|672114323|ref|XP_008776460.1| PREDICTED: 40S ribosomal protein S15a-like [Phoenix dactylifera] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >emb|CBI31713.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 132 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 175 >ref|XP_007154165.1| hypothetical protein PHAVU_003G095800g [Phaseolus vulgaris] gi|561027519|gb|ESW26159.1| hypothetical protein PHAVU_003G095800g [Phaseolus vulgaris] Length = 174 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 131 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 174 >ref|XP_007154598.1| hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] gi|695025464|ref|XP_009399987.1| PREDICTED: 40S ribosomal protein S15a [Musa acuminata subsp. malaccensis] gi|695063180|ref|XP_009420087.1| PREDICTED: 40S ribosomal protein S15a [Musa acuminata subsp. malaccensis] gi|743787305|ref|XP_010922386.1| PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] gi|743869034|ref|XP_010905722.1| PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] gi|747084761|ref|XP_011089803.1| PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] gi|561027952|gb|ESW26592.1| hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006826960.1| PREDICTED: 40S ribosomal protein S15a [Amborella trichopoda] gi|548831389|gb|ERM94197.1| hypothetical protein AMTR_s00010p00192110 [Amborella trichopoda] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >sp|Q9AT34.3|RS15A_DAUCA RecName: Full=40S ribosomal protein S15a gi|13560779|gb|AAK30203.1|AF349962_1 cytoplasmic ribosomal protein S15a [Daucus carota] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_002279090.1| PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] gi|225449601|ref|XP_002284061.1| PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] gi|731399148|ref|XP_010653512.1| PREDICTED: 40S ribosomal protein S15a [Vitis vinifera] gi|147781237|emb|CAN65143.1| hypothetical protein VITISV_007037 [Vitis vinifera] gi|147790711|emb|CAN76515.1| hypothetical protein VITISV_017255 [Vitis vinifera] gi|297741553|emb|CBI32685.3| unnamed protein product [Vitis vinifera] Length = 130 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >emb|CDP09021.1| unnamed protein product [Coffea canephora] Length = 130 Score = 93.2 bits (230), Expect = 7e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGK+LGFFY Sbjct: 87 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKMLGFFY 130 >gb|KMZ74179.1| putative 30S ribosomal protein S8 [Zostera marina] gi|901822523|gb|KMZ74185.1| putative 30S ribosomal protein S8 [Zostera marina] Length = 130 Score = 92.8 bits (229), Expect = 9e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFG+IVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGFIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_010920679.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] Length = 130 Score = 92.8 bits (229), Expect = 9e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 344 EPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 213 EPWTARLLPSRQFG+IVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 87 EPWTARLLPSRQFGFIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130