BLASTX nr result
ID: Papaver32_contig00047049
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00047049 (550 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV92266.1 DUF4283 domain-containing protein [Cephalotus follicu... 58 4e-07 >GAV92266.1 DUF4283 domain-containing protein [Cephalotus follicularis] Length = 207 Score = 58.2 bits (139), Expect = 4e-07 Identities = 36/119 (30%), Positives = 61/119 (51%) Frame = -2 Query: 375 DFPSLPHLNATSGYINGVSNFESTGNQKWISCLKNPVRTETSTKLAYDGPKNIDGEPIAF 196 +FP+LP + + + ST +W + P R + +L++ P ++GE I Sbjct: 44 NFPALPQSSGKASSPVPCPS-PSTPYPQWRQLFQQPHREDV--RLSFHEPITVNGECIVE 100 Query: 195 F*SDELQTHIDLNESSVVGYFVGKRLDFTIVKEKLST*WKTKGDFEMTIYGEQAFMFRF 19 + Q ++ +S+VGYFVGKR+ F IVKE L W+ G+F++ F+F+F Sbjct: 101 PPDEVFQVGVETWSNSLVGYFVGKRIPFKIVKEHLEKKWRKWGNFQIITGANGNFLFKF 159