BLASTX nr result
ID: Papaver32_contig00046325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00046325 (606 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010275032.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 9e-18 XP_006836295.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 6e-12 >XP_010275032.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Nelumbo nucifera] Length = 598 Score = 90.9 bits (224), Expect = 9e-18 Identities = 53/116 (45%), Positives = 69/116 (59%) Frame = +3 Query: 255 HSIVSPLLFKFKFPWKIKVPNSIRVQLVNQEKPMNVQTRVTKLSSPTLQVLSQILKQGPS 434 HS+++ FKF +++P N T + T+QVL+QI K GP Sbjct: 124 HSVITKSTAPFKF----------------RQRPTNFFPMTT--NPATMQVLAQIFKLGPF 165 Query: 435 PDIVTYTTFIKFLGDSGYASEAHELFTFMRESHEPDTIVFTVLIQILCDSKMYGRA 602 DIV YT IKFLGDSG+A+EA ELF MRE+H+PD I FTV+I+IL D KM +A Sbjct: 166 ADIVAYTILIKFLGDSGHAAEALELFNKMRETHQPDIISFTVIIRILIDFKMVDQA 221 >XP_006836295.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Amborella trichopoda] ERM99148.1 hypothetical protein AMTR_s00092p00018230 [Amborella trichopoda] Length = 498 Score = 73.9 bits (180), Expect = 6e-12 Identities = 38/81 (46%), Positives = 52/81 (64%), Gaps = 1/81 (1%) Frame = +3 Query: 363 QTRVTKLSSPTLQVLSQILKQGPSPDIVTYTTFIKFLGDSGYASEAHELFTFMR-ESHEP 539 Q + S+ T Q++++ILK PSP+++ YT FIK LG GY EA+ELF FM+ +P Sbjct: 39 QNKKVGASTITAQIIAKILKISPSPNVIIYTKFIKKLGRLGYVDEAYELFIFMKLYQCKP 98 Query: 540 DTIVFTVLIQILCDSKMYGRA 602 D I FT+LIQ LC S +A Sbjct: 99 DVISFTILIQALCSSNRLNKA 119