BLASTX nr result
ID: Papaver32_contig00046177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00046177 (456 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010259637.1 PREDICTED: heavy metal-associated isoprenylated p... 55 4e-06 >XP_010259637.1 PREDICTED: heavy metal-associated isoprenylated plant protein 3-like [Nelumbo nucifera] Length = 343 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/72 (41%), Positives = 37/72 (51%) Frame = -3 Query: 451 YGGPPAYVMSYRTSYPTVNYGASYYTPPEAYTYRKCVQSGGTGGFFEASPLMDSIETIYD 272 Y PP Y +SY T+YP+ +YGASYY PP Y G+ +P DS E D Sbjct: 275 YCPPPVYAVSYNTAYPSSSYGASYYVPPAPPQYTFTYTHPGSYDAPAPAPPSDSFEMFSD 334 Query: 271 ENDHNESGCWIM 236 E N +GC IM Sbjct: 335 E---NPNGCMIM 343