BLASTX nr result
ID: Papaver32_contig00045256
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00045256 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010529236.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 75 9e-17 XP_010518841.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 74 1e-16 XP_019577589.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 1e-15 XP_018447086.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 1e-15 XP_009108403.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 1e-15 XP_013622244.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 1e-15 KFK28572.1 hypothetical protein AALP_AA7G013800 [Arabis alpina] 72 1e-15 JAU61855.1 26S proteasome non-ATPase regulatory subunit 13 -like... 72 2e-15 JAU37534.1 26S proteasome non-ATPase regulatory subunit 13 -like... 72 2e-15 JAU97264.1 26S proteasome non-ATPase regulatory subunit 13 -like... 72 2e-15 JAU12006.1 26S proteasome non-ATPase regulatory subunit 13 -like... 72 2e-15 XP_006414023.1 hypothetical protein EUTSA_v10025439mg [Eutrema s... 72 2e-15 JAU43987.1 26S proteasome non-ATPase regulatory subunit 13 -like... 71 3e-15 JAU06672.1 26S proteasome non-ATPase regulatory subunit 13 -like... 71 3e-15 JAU54433.1 26S proteasome non-ATPase regulatory subunit 13 -like... 71 3e-15 XP_006281534.1 hypothetical protein CARUB_v10027635mg [Capsella ... 72 6e-15 XP_019577427.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 6e-15 CBI33798.3 unnamed protein product, partial [Vitis vinifera] 77 6e-15 XP_009611841.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 78 7e-15 XP_009794951.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 77 7e-15 >XP_010529236.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Tarenaya hassleriana] Length = 386 Score = 74.7 bits (182), Expect(2) = 9e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI+QI+SLRDRLDNWVDKVHT LLSVEAETPDL + Sbjct: 346 QPRVLGITQIKSLRDRLDNWVDKVHTTLLSVEAETPDLVS 385 Score = 39.3 bits (90), Expect(2) = 9e-17 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQVE TVH+S W PR Sbjct: 326 VHLIEGIIDQVEGTVHIS-----WAQPR 348 >XP_010518841.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Tarenaya hassleriana] Length = 386 Score = 73.9 bits (180), Expect(2) = 1e-16 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRDRLDNW DKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIQQIKSLRDRLDNWADKVHTTLLSVEAETPDLVA 385 Score = 39.7 bits (91), Expect(2) = 1e-16 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQVE TVHVS W PR Sbjct: 326 VHLIEGIIDQVEGTVHVS-----WAQPR 348 >XP_019577589.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Rhinolophus sinicus] Length = 386 Score = 71.6 bits (174), Expect(2) = 1e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 385 Score = 38.5 bits (88), Expect(2) = 1e-15 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV+ TVHVS W PR Sbjct: 326 VHLIEGIIDQVDGTVHVS-----WAQPR 348 >XP_018447086.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Raphanus sativus] Length = 386 Score = 71.6 bits (174), Expect(2) = 1e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 385 Score = 38.5 bits (88), Expect(2) = 1e-15 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV+ TVHVS W PR Sbjct: 326 VHLIEGIIDQVDGTVHVS-----WAQPR 348 >XP_009108403.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Brassica rapa] XP_013656060.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Brassica napus] CDX76502.1 BnaA08g08980D [Brassica napus] Length = 386 Score = 71.6 bits (174), Expect(2) = 1e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 385 Score = 38.5 bits (88), Expect(2) = 1e-15 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV+ TVHVS W PR Sbjct: 326 VHLIEGIIDQVDGTVHVS-----WAQPR 348 >XP_013622244.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Brassica oleracea var. oleracea] XP_013716044.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Brassica napus] CDY69914.1 BnaCnng65930D [Brassica napus] Length = 386 Score = 71.6 bits (174), Expect(2) = 1e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 385 Score = 38.5 bits (88), Expect(2) = 1e-15 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV+ TVHVS W PR Sbjct: 326 VHLIEGIIDQVDGTVHVS-----WAQPR 348 >KFK28572.1 hypothetical protein AALP_AA7G013800 [Arabis alpina] Length = 386 Score = 71.6 bits (174), Expect(2) = 1e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 385 Score = 38.5 bits (88), Expect(2) = 1e-15 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV+ TVHVS W PR Sbjct: 326 VHLIEGIIDQVDGTVHVS-----WAQPR 348 >JAU61855.1 26S proteasome non-ATPase regulatory subunit 13 -like protein A, partial [Noccaea caerulescens] Length = 427 Score = 71.6 bits (174), Expect(2) = 2e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 387 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 426 Score = 37.7 bits (86), Expect(2) = 2e-15 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV TVHVS W PR Sbjct: 367 VHLIEGIIDQVNGTVHVS-----WAQPR 389 >JAU37534.1 26S proteasome non-ATPase regulatory subunit 13 -like protein A, partial [Noccaea caerulescens] Length = 421 Score = 71.6 bits (174), Expect(2) = 2e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 381 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 420 Score = 37.7 bits (86), Expect(2) = 2e-15 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV TVHVS W PR Sbjct: 361 VHLIEGIIDQVNGTVHVS-----WAQPR 383 >JAU97264.1 26S proteasome non-ATPase regulatory subunit 13 -like protein A, partial [Noccaea caerulescens] Length = 420 Score = 71.6 bits (174), Expect(2) = 2e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 380 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 419 Score = 37.7 bits (86), Expect(2) = 2e-15 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV TVHVS W PR Sbjct: 360 VHLIEGIIDQVNGTVHVS-----WAQPR 382 >JAU12006.1 26S proteasome non-ATPase regulatory subunit 13 -like protein A [Noccaea caerulescens] Length = 386 Score = 71.6 bits (174), Expect(2) = 2e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 385 Score = 37.7 bits (86), Expect(2) = 2e-15 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV TVHVS W PR Sbjct: 326 VHLIEGIIDQVNGTVHVS-----WAQPR 348 >XP_006414023.1 hypothetical protein EUTSA_v10025439mg [Eutrema salsugineum] ESQ55476.1 hypothetical protein EUTSA_v10025439mg [Eutrema salsugineum] Length = 386 Score = 71.6 bits (174), Expect(2) = 2e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 385 Score = 37.7 bits (86), Expect(2) = 2e-15 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGI+DQV+ TVHVS W PR Sbjct: 326 VHLIEGILDQVDGTVHVS-----WAQPR 348 >JAU43987.1 26S proteasome non-ATPase regulatory subunit 13 -like protein B, partial [Noccaea caerulescens] Length = 218 Score = 71.2 bits (173), Expect(2) = 3e-15 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD WVDKVHT LLSVEAETPDL A Sbjct: 178 QPRVLGIPQIKSLRDQLDGWVDKVHTTLLSVEAETPDLVA 217 Score = 37.7 bits (86), Expect(2) = 3e-15 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGI+DQV+ TVHVS W PR Sbjct: 158 VHLIEGILDQVDGTVHVS-----WAQPR 180 >JAU06672.1 26S proteasome non-ATPase regulatory subunit 13 -like protein B, partial [Noccaea caerulescens] JAU82400.1 26S proteasome non-ATPase regulatory subunit 13 -like protein B, partial [Noccaea caerulescens] Length = 218 Score = 71.2 bits (173), Expect(2) = 3e-15 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD WVDKVHT LLSVEAETPDL A Sbjct: 178 QPRVLGIPQIKSLRDQLDGWVDKVHTTLLSVEAETPDLVA 217 Score = 37.7 bits (86), Expect(2) = 3e-15 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGI+DQV+ TVHVS W PR Sbjct: 158 VHLIEGILDQVDGTVHVS-----WAQPR 180 >JAU54433.1 26S proteasome non-ATPase regulatory subunit 13 -like protein B, partial [Noccaea caerulescens] Length = 218 Score = 71.2 bits (173), Expect(2) = 3e-15 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD WVDKVHT LLSVEAETPDL A Sbjct: 178 QPRVLGIPQIKSLRDQLDGWVDKVHTTLLSVEAETPDLVA 217 Score = 37.4 bits (85), Expect(2) = 3e-15 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGI+DQV+ TVHVS W PR Sbjct: 158 VHLIEGILDQVDRTVHVS-----WAQPR 180 >XP_006281534.1 hypothetical protein CARUB_v10027635mg [Capsella rubella] EOA14432.1 hypothetical protein CARUB_v10027635mg [Capsella rubella] Length = 386 Score = 72.4 bits (176), Expect(2) = 6e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI++LRD+LDNWVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKALRDQLDNWVDKVHTTLLSVEAETPDLVA 385 Score = 35.4 bits (80), Expect(2) = 6e-15 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV TV+VS W PR Sbjct: 326 VHLIEGIIDQVNGTVYVS-----WAQPR 348 >XP_019577427.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog A [Rhinolophus sinicus] Length = 386 Score = 71.6 bits (174), Expect(2) = 6e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 94 QPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 QPRVLGI QI+SLRD+LD+WVDKVHT LLSVEAETPDL A Sbjct: 346 QPRVLGIPQIKSLRDQLDSWVDKVHTTLLSVEAETPDLVA 385 Score = 36.2 bits (82), Expect(2) = 6e-15 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = +2 Query: 38 VHLIEGIIDQVEATVHVSCSREYWVSPR 121 VHLIEGIIDQV+ TV+VS W PR Sbjct: 326 VHLIEGIIDQVDGTVYVS-----WAQPR 348 >CBI33798.3 unnamed protein product, partial [Vitis vinifera] Length = 181 Score = 77.0 bits (188), Expect = 6e-15 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 91 MQPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 +QPRVLGI QI+SLRDRLDNWVDKVHTALLSVEAETPDL A Sbjct: 140 VQPRVLGIPQIKSLRDRLDNWVDKVHTALLSVEAETPDLVA 180 >XP_009611841.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Nicotiana tomentosiformis] Length = 227 Score = 77.8 bits (190), Expect = 7e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 91 MQPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 +QPRVLGI+QI+SLRDRLDNWVDKVHTALLSVEAETPDL A Sbjct: 186 VQPRVLGITQIKSLRDRLDNWVDKVHTALLSVEAETPDLVA 226 >XP_009794951.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like, partial [Nicotiana sylvestris] Length = 192 Score = 77.0 bits (188), Expect = 7e-15 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 91 MQPRVLGISQIESLRDRLDNWVDKVHTALLSVEAETPDLAA 213 +QPRVLGI QI+SLRDRLDNWVDKVHTALLSVEAETPDL A Sbjct: 151 VQPRVLGIPQIKSLRDRLDNWVDKVHTALLSVEAETPDLVA 191