BLASTX nr result
ID: Papaver32_contig00044866
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00044866 (579 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT48323.1 F-box protein FBW2, partial [Anthurium amnicola] 53 6e-06 >JAT48323.1 F-box protein FBW2, partial [Anthurium amnicola] Length = 111 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 2 LLPDALGLIFKKLALQDQDMLTMIPRVCKSWGK 100 ++PDALGLIF KL+LQD +LT++PRVCKSWGK Sbjct: 43 MIPDALGLIFHKLSLQD--ILTIVPRVCKSWGK 73