BLASTX nr result
ID: Papaver32_contig00044705
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00044705 (507 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010254483.1 PREDICTED: probable polygalacturonase At3g15720 [... 55 8e-06 >XP_010254483.1 PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera] Length = 425 Score = 55.1 bits (131), Expect = 8e-06 Identities = 21/44 (47%), Positives = 30/44 (68%) Frame = +1 Query: 373 KIDHKWAFRNAWQAMCRGAIGTPRMVVPKRKIFLLKPIDFVGPC 504 + D AF NAW+A C A G+P +++P K FLL P++F+GPC Sbjct: 64 RTDDSKAFLNAWEAACGDASGSPTLIIPAMKTFLLHPVEFIGPC 107