BLASTX nr result
ID: Papaver32_contig00044666
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00044666 (476 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018723932.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 1e-08 XP_015874799.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 1e-06 XP_004494504.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 3e-06 >XP_018723932.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Eucalyptus grandis] KCW84998.1 hypothetical protein EUGRSUZ_B01821 [Eucalyptus grandis] Length = 717 Score = 62.8 bits (151), Expect = 1e-08 Identities = 46/105 (43%), Positives = 55/105 (52%), Gaps = 16/105 (15%) Frame = -3 Query: 402 SLINHFSHTHKSSEALNLFNQMREISLHPNQFTLSAVLPG*E--------KQIHYLVMKY 247 SLI SH +K +AL LFNQMR ++PN FT SAVLP +QIH LV+K+ Sbjct: 113 SLITQQSHANKPFKALALFNQMRRTGIYPNHFTFSAVLPACAETMVLSHGEQIHCLVIKH 172 Query: 246 GS*CC*EWFDQHVWEVL--------*MSYA*KLFDEMRERNLNTF 136 G C D V L M A K+FDEM ERNL T+ Sbjct: 173 GFGC-----DIFVGSALVDMYAKCSRMDAAQKMFDEMPERNLVTW 212 >XP_015874799.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Ziziphus jujuba] Length = 712 Score = 57.4 bits (137), Expect = 1e-06 Identities = 39/104 (37%), Positives = 55/104 (52%), Gaps = 18/104 (17%) Frame = -3 Query: 402 SLINHFSHTHKSSEALNLFNQMREISLHPNQFTLSAVLPG*E--------KQIHYLVMKY 247 SLI SH+H+ EAL FN+MR +++PN FT SA+L +Q+H L+ K+ Sbjct: 108 SLITQLSHSHRPFEALAFFNRMRCSAVYPNHFTFSAILSACADTMIVFHGEQLHCLIWKH 167 Query: 246 GS*CC*EWFDQHVW----------EVL*MSYA*KLFDEMRERNL 145 G FD HV+ + M+ A ++FDEM ERNL Sbjct: 168 G-------FDAHVFVCSALVDMYAKSSEMTLAERVFDEMPERNL 204 >XP_004494504.1 PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Cicer arietinum] Length = 641 Score = 56.2 bits (134), Expect = 3e-06 Identities = 37/98 (37%), Positives = 53/98 (54%), Gaps = 12/98 (12%) Frame = -3 Query: 402 SLINHFSHTHKSSEALNLFNQMREISLHPNQFTLSAVLPG*E--------KQIHYLVMKY 247 +LI SH +K +AL FN+MR ++PNQFT SA+LP +Q+H L+ K+ Sbjct: 37 TLITQLSHLNKPFQALTHFNRMRNTGIYPNQFTFSAILPSCAHTKLLTHGQQMHSLIFKH 96 Query: 246 G----S*CC*EWFDQHVWEVL*MSYA*KLFDEMRERNL 145 G + D + + L M +A K+FDEM RNL Sbjct: 97 GFLNDTFVATSLLDMYA-KCLNMFFAEKVFDEMYHRNL 133