BLASTX nr result
ID: Papaver32_contig00044624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00044624 (472 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EMS53368.1 Protein H2A.6 [Triticum urartu] 70 2e-12 AEW08720.1 hypothetical protein CL1360Contig1_05, partial [Pinus... 68 2e-12 AAB00193.1 histone H2A [Triticum aestivum] CAA64423.1 histone H2... 70 2e-12 KQL13356.1 hypothetical protein SETIT_023519mg [Setaria italica] 70 3e-12 CUT18444.1 H2A.W.3, partial [Lilium davidii var. unicolor] 70 3e-12 EMT24732.1 Protein H2A.5 [Aegilops tauschii] 70 3e-12 XP_020183598.1 protein H2A.5 [Aegilops tauschii subsp. tauschii] 70 3e-12 Q43213.3 RecName: Full=Protein H2A.5; AltName: Full=wcH2A-2 BAA0... 70 3e-12 XP_020159935.1 histone H2A.1 [Aegilops tauschii subsp. tauschii]... 70 3e-12 XP_020159933.1 histone H2A.1-like [Aegilops tauschii subsp. taus... 70 3e-12 XP_020159930.1 histone H2A.1-like [Aegilops tauschii subsp. taus... 70 3e-12 P02275.2 RecName: Full=Histone H2A.1; AltName: Full=wcH2A-9 BAA0... 70 3e-12 EMT24733.1 Protein H2A.6 [Aegilops tauschii] 70 3e-12 XP_020179990.1 histone H2A.1-like [Aegilops tauschii subsp. taus... 70 3e-12 EMS64812.1 Protein H2A.6 [Triticum urartu] 70 3e-12 XP_020159939.1 histone H2A.1-like [Aegilops tauschii subsp. taus... 70 3e-12 XP_020159934.1 histone H2A.1-like [Aegilops tauschii subsp. taus... 70 3e-12 EMS46915.1 Histone H2A.1 [Triticum urartu] 70 3e-12 BAJ98455.1 predicted protein [Hordeum vulgare subsp. vulgare] BA... 70 3e-12 XP_020197875.1 protein H2A.6 [Aegilops tauschii subsp. tauschii] 70 3e-12 >EMS53368.1 Protein H2A.6 [Triticum urartu] Length = 125 Score = 69.7 bits (169), Expect = 2e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >AEW08720.1 hypothetical protein CL1360Contig1_05, partial [Pinus lambertiana] Length = 71 Score = 68.2 bits (165), Expect = 2e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+G+GAPVYLAAVLEYLA EV+ +AG + Sbjct: 8 GRIGRYLKKGRYAQRLGTGAPVYLAAVLEYLAA-EVLELAGNA 49 >AAB00193.1 histone H2A [Triticum aestivum] CAA64423.1 histone H2A [Triticum aestivum] Length = 146 Score = 70.1 bits (170), Expect = 2e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >KQL13356.1 hypothetical protein SETIT_023519mg [Setaria italica] Length = 141 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 38 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 79 >CUT18444.1 H2A.W.3, partial [Lilium davidii var. unicolor] Length = 142 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 33 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 74 >EMT24732.1 Protein H2A.5 [Aegilops tauschii] Length = 143 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >XP_020183598.1 protein H2A.5 [Aegilops tauschii subsp. tauschii] Length = 145 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >Q43213.3 RecName: Full=Protein H2A.5; AltName: Full=wcH2A-2 BAA07276.1 protein H2A [Triticum aestivum] prf||2108279A histone H2A:ISOTYPE=2 [Triticum aestivum] Length = 145 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >XP_020159935.1 histone H2A.1 [Aegilops tauschii subsp. tauschii] XP_020159941.1 histone H2A.1 [Aegilops tauschii subsp. tauschii] Length = 146 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >XP_020159933.1 histone H2A.1-like [Aegilops tauschii subsp. tauschii] Length = 146 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >XP_020159930.1 histone H2A.1-like [Aegilops tauschii subsp. tauschii] Length = 146 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >P02275.2 RecName: Full=Histone H2A.1; AltName: Full=wcH2A-9 BAA07279.1 protein H2A [Triticum aestivum] prf||2108279B histone H2A:ISOTYPE=9 [Triticum aestivum] Length = 146 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >EMT24733.1 Protein H2A.6 [Aegilops tauschii] Length = 146 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >XP_020179990.1 histone H2A.1-like [Aegilops tauschii subsp. tauschii] EMT16548.1 Protein H2A.6 [Aegilops tauschii] Length = 146 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >EMS64812.1 Protein H2A.6 [Triticum urartu] Length = 146 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >XP_020159939.1 histone H2A.1-like [Aegilops tauschii subsp. tauschii] Length = 147 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >XP_020159934.1 histone H2A.1-like [Aegilops tauschii subsp. tauschii] EMT17582.1 Histone H2A.1 [Aegilops tauschii] Length = 147 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >EMS46915.1 Histone H2A.1 [Triticum urartu] Length = 147 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >BAJ98455.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK05318.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 147 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67 >XP_020197875.1 protein H2A.6 [Aegilops tauschii subsp. tauschii] Length = 148 Score = 69.7 bits (169), Expect = 3e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 472 GRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAGMEVVAVAGRS 344 GRIGRYLKKGRYAQR+GSGAPVYLAAVLEYLA EV+ +AG + Sbjct: 26 GRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAA-EVLELAGNA 67