BLASTX nr result
ID: Papaver32_contig00043715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00043715 (511 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010440236.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 7e-11 KFK33805.1 hypothetical protein AALP_AA5G062400 [Arabis alpina] 54 7e-11 XP_006283650.1 hypothetical protein CARUB_v10004707mg [Capsella ... 54 7e-11 OMO53631.1 hypothetical protein CCACVL1_28485 [Corchorus capsula... 54 1e-10 XP_017975793.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 XP_016696122.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 AAO22800.1 putative PRL1 protein [Arabidopsis thaliana] BAH30520... 54 2e-10 NP_193325.1 pleiotropic regulatory locus 1 [Arabidopsis thaliana... 54 2e-10 XP_012487486.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 XP_012482120.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 EOY06545.1 Pleiotropic regulatory locus 1 [Theobroma cacao] 54 2e-10 AAM61532.1 PRL1 protein [Arabidopsis thaliana] OAP00649.1 PRL1 [... 54 2e-10 XP_017638687.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 XP_016720888.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 JAT57844.1 Protein pleiotropic regulatory locus 1 [Anthurium amn... 52 2e-10 XP_012487487.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 XP_010449880.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 XP_010434910.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 XP_019576680.1 PREDICTED: protein pleiotropic regulatory locus 1... 54 2e-10 XP_006414428.1 hypothetical protein EUTSA_v10025068mg [Eutrema s... 54 2e-10 >XP_010440236.1 PREDICTED: protein pleiotropic regulatory locus 1 [Camelina sativa] Length = 481 Score = 53.5 bits (127), Expect(2) = 7e-11 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 246 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 281 Score = 40.4 bits (93), Expect(2) = 7e-11 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGHENTV SVFTRP Sbjct: 286 TKMQIFALSGHENTVCSVFTRP 307 >KFK33805.1 hypothetical protein AALP_AA5G062400 [Arabis alpina] Length = 481 Score = 53.5 bits (127), Expect(2) = 7e-11 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 246 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 281 Score = 40.4 bits (93), Expect(2) = 7e-11 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGHENTV SVFTRP Sbjct: 286 TKMQIFALSGHENTVCSVFTRP 307 >XP_006283650.1 hypothetical protein CARUB_v10004707mg [Capsella rubella] EOA16548.1 hypothetical protein CARUB_v10004707mg [Capsella rubella] Length = 481 Score = 53.5 bits (127), Expect(2) = 7e-11 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 246 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 281 Score = 40.4 bits (93), Expect(2) = 7e-11 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGHENTV SVFTRP Sbjct: 286 TKMQIFALSGHENTVCSVFTRP 307 >OMO53631.1 hypothetical protein CCACVL1_28485 [Corchorus capsularis] Length = 318 Score = 53.9 bits (128), Expect(2) = 1e-10 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 83 KVIRSYHGHLSGVYCLALHPTIDVLLTGGRDSVCRV 118 Score = 39.3 bits (90), Expect(2) = 1e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 123 TKMQIFALSGHDNTVCSVFTRP 144 >XP_017975793.1 PREDICTED: protein pleiotropic regulatory locus 1 [Theobroma cacao] Length = 486 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 251 KVIRSYHGHLSGVYCLALHPTIDILLTGGRDSVCRV 286 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 291 TKMQIFALSGHDNTVCSVFTRP 312 >XP_016696122.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Gossypium hirsutum] Length = 486 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 251 KVIRSYHGHLSGVYCLALHPTIDILLTGGRDSVCRV 286 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 291 TKMQIFALSGHDNTVCSVFTRP 312 >AAO22800.1 putative PRL1 protein [Arabidopsis thaliana] BAH30520.1 hypothetical protein, partial [Arabidopsis thaliana] Length = 486 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 251 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 286 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 291 TKMQIFALSGHDNTVCSVFTRP 312 >NP_193325.1 pleiotropic regulatory locus 1 [Arabidopsis thaliana] Q42384.1 RecName: Full=Protein pleiotropic regulatory locus 1; Short=Protein PRL1; AltName: Full=MOS4-associated complex protein 2; Short=MAC protein 2 CAA58031.1 PRL1 [Arabidopsis thaliana] CAA58032.1 PRL1 [Arabidopsis thaliana] CAB10369.1 PRL1 protein [Arabidopsis thaliana] CAB78632.1 PRL1 protein [Arabidopsis thaliana] ABI93932.1 At4g15900 [Arabidopsis thaliana] AEE83664.1 pleiotropic regulatory locus 1 [Arabidopsis thaliana] Length = 486 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 251 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 286 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 291 TKMQIFALSGHDNTVCSVFTRP 312 >XP_012487486.1 PREDICTED: protein pleiotropic regulatory locus 1-like isoform X1 [Gossypium raimondii] KJB38573.1 hypothetical protein B456_006G261700 [Gossypium raimondii] Length = 486 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 251 KVIRSYHGHLSGVYCLALHPTIDILLTGGRDSVCRV 286 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 291 TKMQIFALSGHDNTVCSVFTRP 312 >XP_012482120.1 PREDICTED: protein pleiotropic regulatory locus 1 [Gossypium raimondii] KJB28655.1 hypothetical protein B456_005G060900 [Gossypium raimondii] Length = 486 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 251 KVIRSYHGHLSGVYCLALHPTIDILLTGGRDSVCRV 286 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 291 TKMQIFALSGHDNTVCSVFTRP 312 >EOY06545.1 Pleiotropic regulatory locus 1 [Theobroma cacao] Length = 486 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 251 KVIRSYHGHLSGVYCLALHPTIDILLTGGRDSVCRV 286 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 291 TKMQIFALSGHDNTVCSVFTRP 312 >AAM61532.1 PRL1 protein [Arabidopsis thaliana] OAP00649.1 PRL1 [Arabidopsis thaliana] Length = 486 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 251 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 286 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 291 TKMQIFALSGHDNTVCSVFTRP 312 >XP_017638687.1 PREDICTED: protein pleiotropic regulatory locus 1 [Gossypium arboreum] Length = 484 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 249 KVIRSYHGHLSGVYCLALHPTIDILLTGGRDSVCRV 284 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 289 TKMQIFALSGHDNTVCSVFTRP 310 >XP_016720888.1 PREDICTED: protein pleiotropic regulatory locus 1-like [Gossypium hirsutum] Length = 484 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 249 KVIRSYHGHLSGVYCLALHPTIDILLTGGRDSVCRV 284 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 289 TKMQIFALSGHDNTVCSVFTRP 310 >JAT57844.1 Protein pleiotropic regulatory locus 1 [Anthurium amnicola] Length = 484 Score = 52.0 bits (123), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 249 KVIRSYHGHLSGVYCLALHPTLDLLFTGGRDSVCRV 284 Score = 40.8 bits (94), Expect(2) = 2e-10 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRPM 273 TK + FALSGHENTV SVFTRP+ Sbjct: 289 TKAMVFALSGHENTVCSVFTRPL 311 >XP_012487487.1 PREDICTED: protein pleiotropic regulatory locus 1-like isoform X2 [Gossypium raimondii] KJB38572.1 hypothetical protein B456_006G261700 [Gossypium raimondii] Length = 483 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT +L GG DSV RV Sbjct: 248 KVIRSYHGHLSGVYCLALHPTIDILLTGGRDSVCRV 283 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 288 TKMQIFALSGHDNTVCSVFTRP 309 >XP_010449880.1 PREDICTED: protein pleiotropic regulatory locus 1 [Camelina sativa] Length = 482 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 247 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 282 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FAL+GHENTV SVFTRP Sbjct: 287 TKMQIFALTGHENTVCSVFTRP 308 >XP_010434910.1 PREDICTED: protein pleiotropic regulatory locus 1 [Camelina sativa] Length = 482 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 247 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 282 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FAL+GHENTV SVFTRP Sbjct: 287 TKMQIFALTGHENTVCSVFTRP 308 >XP_019576680.1 PREDICTED: protein pleiotropic regulatory locus 1 [Rhinolophus sinicus] Length = 481 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 246 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 281 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 286 TKMQIFALSGHDNTVCSVFTRP 307 >XP_006414428.1 hypothetical protein EUTSA_v10025068mg [Eutrema salsugineum] BAJ33622.1 unnamed protein product [Eutrema halophilum] ESQ55881.1 hypothetical protein EUTSA_v10025068mg [Eutrema salsugineum] Length = 481 Score = 53.5 bits (127), Expect(2) = 2e-10 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -1 Query: 454 KVIRSYQGHLSGV*CLALHPTDVVLTGGGGDSVFRV 347 KVIRSY GHLSGV CLALHPT VL GG DSV RV Sbjct: 246 KVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRV 281 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 341 TKMLAFALSGHENTVYSVFTRP 276 TKM FALSGH+NTV SVFTRP Sbjct: 286 TKMQIFALSGHDNTVCSVFTRP 307