BLASTX nr result
ID: Papaver32_contig00043659
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00043659 (1220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007142080.1 hypothetical protein PHAVU_008G250900g [Phaseolus... 44 7e-06 >XP_007142080.1 hypothetical protein PHAVU_008G250900g [Phaseolus vulgaris] ESW14074.1 hypothetical protein PHAVU_008G250900g [Phaseolus vulgaris] Length = 1887 Score = 44.3 bits (103), Expect(2) = 7e-06 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -1 Query: 689 EASTLCCEWVVEVLEYVCPSRYEEQSLLDQLI 594 E ++LCC WV+EVLE+VC EEQSLL L+ Sbjct: 955 EIASLCCTWVLEVLEHVCVDENEEQSLLHYLL 986 Score = 35.0 bits (79), Expect(2) = 7e-06 Identities = 15/24 (62%), Positives = 22/24 (91%) Frame = -2 Query: 784 KSITVDNRKKLANILVRTIRFVIF 713 KS++ D+RK+L+NILV++IRF IF Sbjct: 923 KSLSSDSRKRLSNILVQSIRFAIF 946