BLASTX nr result
ID: Papaver32_contig00043503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00043503 (467 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010232279.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 3e-08 AEB39780.1 pentatricopeptide repeat protein 45 [Funaria hygromet... 62 3e-08 XP_001754449.1 predicted protein [Physcomitrella patens] EDQ8089... 62 3e-08 XP_001785902.1 predicted protein [Physcomitrella patens] EDQ4928... 62 4e-08 AFG48749.1 hypothetical protein 0_2087_01, partial [Pinus taeda] 58 4e-08 AFG48743.1 hypothetical protein 0_2087_01, partial [Pinus taeda] 58 4e-08 AFG48740.1 hypothetical protein 0_2087_01, partial [Pinus taeda]... 58 4e-08 AFG48739.1 hypothetical protein 0_2087_01, partial [Pinus taeda] 58 4e-08 AEW07459.1 hypothetical protein 0_2087_01, partial [Pinus radiata] 58 4e-08 BAP69206.1 pentatricopeptide repeat protein [Physcomitrella patens] 62 4e-08 ONK79630.1 uncharacterized protein A4U43_C01F8330 [Asparagus off... 61 5e-08 XP_010487003.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 5e-08 XP_019092892.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 5e-08 CDP20116.1 unnamed protein product [Coffea canephora] 56 5e-08 XP_002977881.1 hypothetical protein SELMODRAFT_107359 [Selaginel... 61 6e-08 XP_012856389.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 6e-08 XP_002979445.1 hypothetical protein SELMODRAFT_110780 [Selaginel... 61 6e-08 XP_011072675.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 6e-08 AFG48752.1 hypothetical protein 0_2087_01, partial [Pinus taeda] 57 7e-08 ONK61767.1 uncharacterized protein A4U43_C08F33380 [Asparagus of... 60 8e-08 >XP_010232279.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Brachypodium distachyon] KQK09627.1 hypothetical protein BRADI_2g49207 [Brachypodium distachyon] Length = 909 Score = 62.0 bits (149), Expect = 3e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 K ISK+VGR+I ARD KRFHHFE+GVC+CN++W Sbjct: 877 KIISKLVGRQIIARDAKRFHHFENGVCSCNDYW 909 >AEB39780.1 pentatricopeptide repeat protein 45 [Funaria hygrometrica] Length = 1097 Score = 62.0 bits (149), Expect = 3e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISKI GR+I ARD KRFHHF+DGVC+C ++W Sbjct: 1065 KFISKITGREIVARDAKRFHHFKDGVCSCGDYW 1097 >XP_001754449.1 predicted protein [Physcomitrella patens] EDQ80899.1 predicted protein [Physcomitrella patens] Length = 723 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+VGR+I ARD +RFHHF DGVC+C +FW Sbjct: 691 KFISKVVGREIIARDAQRFHHFADGVCSCGDFW 723 >XP_001785902.1 predicted protein [Physcomitrella patens] EDQ49285.1 predicted protein [Physcomitrella patens] Length = 908 Score = 61.6 bits (148), Expect = 4e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+ GR+I ARD KRFHHF+DGVC+C ++W Sbjct: 876 KFISKVTGREIVARDAKRFHHFKDGVCSCGDYW 908 >AFG48749.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 57.8 bits (138), Expect = 4e-08 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+ R+I RDTKRFHHF+DG C+C EFW Sbjct: 63 KFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >AFG48743.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 57.8 bits (138), Expect = 4e-08 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+ R+I RDTKRFHHF+DG C+C EFW Sbjct: 63 KFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >AFG48740.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48741.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48742.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48744.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48745.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48746.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48747.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48748.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48750.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48751.1 hypothetical protein 0_2087_01, partial [Pinus taeda] AFG48753.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 57.8 bits (138), Expect = 4e-08 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+ R+I RDTKRFHHF+DG C+C EFW Sbjct: 63 KFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >AFG48739.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 57.8 bits (138), Expect = 4e-08 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+ R+I RDTKRFHHF+DG C+C EFW Sbjct: 63 KFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >AEW07459.1 hypothetical protein 0_2087_01, partial [Pinus radiata] Length = 95 Score = 57.8 bits (138), Expect = 4e-08 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+ R+I RDTKRFHHF+DG C+C EFW Sbjct: 63 KFISKVYEREIILRDTKRFHHFKDGQCSCREFW 95 >BAP69206.1 pentatricopeptide repeat protein [Physcomitrella patens] Length = 1097 Score = 61.6 bits (148), Expect = 4e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+ GR+I ARD KRFHHF+DGVC+C ++W Sbjct: 1065 KFISKVTGREIVARDAKRFHHFKDGVCSCGDYW 1097 >ONK79630.1 uncharacterized protein A4U43_C01F8330 [Asparagus officinalis] Length = 635 Score = 61.2 bits (147), Expect = 5e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 K ISKIVGR I ARD KRFHHFE+GVC+CN++W Sbjct: 603 KIISKIVGRLIIARDIKRFHHFENGVCSCNDYW 635 >XP_010487003.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Camelina sativa] Length = 695 Score = 61.2 bits (147), Expect = 5e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 K ISK+VGR+I RDT RFHHF+DGVC+CN++W Sbjct: 663 KLISKLVGREIVVRDTNRFHHFKDGVCSCNDYW 695 >XP_019092892.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Camelina sativa] Length = 695 Score = 61.2 bits (147), Expect = 5e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 K ISK+VGR+I RDT RFHHF+DGVC+CN++W Sbjct: 663 KLISKLVGREIVVRDTNRFHHFKDGVCSCNDYW 695 >CDP20116.1 unnamed protein product [Coffea canephora] Length = 54 Score = 56.2 bits (134), Expect = 5e-08 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 K ISK+ GR I RD RFHHF+DGVC+CN++W Sbjct: 22 KLISKVTGRLIILRDANRFHHFKDGVCSCNDYW 54 >XP_002977881.1 hypothetical protein SELMODRAFT_107359 [Selaginella moellendorffii] EFJ21219.1 hypothetical protein SELMODRAFT_107359 [Selaginella moellendorffii] Length = 464 Score = 60.8 bits (146), Expect = 6e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFIS+I GR+I RD RFHHFEDGVC+CN++W Sbjct: 432 KFISRICGRRIVVRDCNRFHHFEDGVCSCNDYW 464 >XP_012856389.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Erythranthe guttata] EYU21282.1 hypothetical protein MIMGU_mgv11b020544mg [Erythranthe guttata] Length = 613 Score = 60.8 bits (146), Expect = 6e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 K ISKIVGR+I ARD+KRFHHF DG C+CN++W Sbjct: 581 KIISKIVGREIIARDSKRFHHFRDGSCSCNDYW 613 >XP_002979445.1 hypothetical protein SELMODRAFT_110780 [Selaginella moellendorffii] EFJ19334.1 hypothetical protein SELMODRAFT_110780 [Selaginella moellendorffii] Length = 637 Score = 60.8 bits (146), Expect = 6e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFIS+I GR+I RD RFHHFEDGVC+CN++W Sbjct: 605 KFISRICGRRIVVRDCNRFHHFEDGVCSCNDYW 637 >XP_011072675.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial [Sesamum indicum] XP_011072676.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial [Sesamum indicum] Length = 683 Score = 60.8 bits (146), Expect = 6e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 K ISKIVGR+I ARD+KRFHHF DG C+CN++W Sbjct: 651 KIISKIVGREIIARDSKRFHHFRDGSCSCNDYW 683 >AFG48752.1 hypothetical protein 0_2087_01, partial [Pinus taeda] Length = 95 Score = 57.0 bits (136), Expect = 7e-08 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KFISK+ R+I RDTKRFHHF+DG C+C EFW Sbjct: 63 KFISKVYEREIILRDTKRFHHFKDGQCSCMEFW 95 >ONK61767.1 uncharacterized protein A4U43_C08F33380 [Asparagus officinalis] Length = 498 Score = 60.5 bits (145), Expect = 8e-08 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 3 KFISKIVGRKITARDTKRFHHFEDGVCNCNEFW 101 KF+SKIV RK+ RD RFHHFEDG C+CN++W Sbjct: 466 KFVSKIVNRKLVVRDASRFHHFEDGACSCNDYW 498