BLASTX nr result
ID: Papaver32_contig00043204
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00043204 (615 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAF70071.1 S-adenosyl-L-homocysteinase II, partial [Lupinus luteus] 52 9e-06 >AAF70071.1 S-adenosyl-L-homocysteinase II, partial [Lupinus luteus] Length = 90 Score = 52.4 bits (124), Expect = 9e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +2 Query: 419 NLHRYHHRLPDGLMKATDVMITAKIVIVAGNGDLGK 526 NL+ H LPDGLM+ATDVMI K+ +VAG GD+GK Sbjct: 37 NLYGCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGK 72