BLASTX nr result
ID: Papaver32_contig00042977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00042977 (757 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010270186.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 4e-18 XP_010270184.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 4e-18 XP_008800619.1 PREDICTED: pentatricopeptide repeat-containing pr... 93 6e-18 EEF30685.1 pentatricopeptide repeat-containing protein, putative... 89 1e-16 XP_015582408.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 1e-16 KDO58425.1 hypothetical protein CISIN_1g002387mg [Citrus sinensis] 89 2e-16 XP_008809556.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 2e-16 XP_006447755.1 hypothetical protein CICLE_v10014182mg [Citrus cl... 88 3e-16 XP_018852148.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 3e-16 ERN18345.1 hypothetical protein AMTR_s00055p00197790 [Amborella ... 88 4e-16 XP_006856878.2 PREDICTED: pentatricopeptide repeat-containing pr... 88 4e-16 OAY34974.1 hypothetical protein MANES_12G061200 [Manihot esculenta] 87 5e-16 OAY34973.1 hypothetical protein MANES_12G061200 [Manihot esculenta] 87 6e-16 XP_012081436.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 1e-15 XP_010943853.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 1e-15 XP_017190183.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 2e-15 XP_019198545.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 2e-15 XP_009365209.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 3e-15 XP_016443250.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 6e-15 XP_009767096.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 6e-15 >XP_010270186.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Nelumbo nucifera] Length = 773 Score = 93.6 bits (231), Expect = 4e-18 Identities = 45/69 (65%), Positives = 54/69 (78%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LFE +L GQW+PD IVWT+LIDGLLKEG+S+VC KF HIMES+ L+ QT +ILA E+S Sbjct: 705 LFEGMLEGQWNPDEIVWTVLIDGLLKEGESEVCMKFLHIMESKSYALNFQTYVILAREMS 764 Query: 575 KGDKSIETD 549 D SIE D Sbjct: 765 NQDSSIEKD 773 >XP_010270184.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Nelumbo nucifera] XP_010270185.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Nelumbo nucifera] XP_010270187.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Nelumbo nucifera] Length = 924 Score = 93.6 bits (231), Expect = 4e-18 Identities = 45/69 (65%), Positives = 54/69 (78%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LFE +L GQW+PD IVWT+LIDGLLKEG+S+VC KF HIMES+ L+ QT +ILA E+S Sbjct: 856 LFEGMLEGQWNPDEIVWTVLIDGLLKEGESEVCMKFLHIMESKSYALNFQTYVILAREMS 915 Query: 575 KGDKSIETD 549 D SIE D Sbjct: 916 NQDSSIEKD 924 >XP_008800619.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Phoenix dactylifera] XP_008800620.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Phoenix dactylifera] XP_008800623.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Phoenix dactylifera] Length = 898 Score = 93.2 bits (230), Expect = 6e-18 Identities = 44/75 (58%), Positives = 56/75 (74%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 +FEN+LL W+PD IVWTILIDGLLK+GK DVC KF H+ME++ C + QT +ILA E+S Sbjct: 822 IFENMLLQHWNPDEIVWTILIDGLLKDGKLDVCMKFLHVMEAKDCKPTFQTYVILAREVS 881 Query: 575 KGDKSIETDCIADGL 531 K +K IE + D L Sbjct: 882 KEEKCIEMSLVGDVL 896 >EEF30685.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 821 Score = 89.4 bits (220), Expect = 1e-16 Identities = 43/75 (57%), Positives = 57/75 (76%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 +F+++L QW+ D+IVWT+L+DGLL+EG SD+C KF ++MESR CT S T +ILA ELS Sbjct: 740 IFQSLLKKQWNSDLIVWTVLVDGLLQEGDSDLCMKFLYLMESRNCTPSLHTYIILARELS 799 Query: 575 KGDKSIETDCIADGL 531 K KSI TD I + L Sbjct: 800 KVGKSIGTDQIGNRL 814 >XP_015582408.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Ricinus communis] Length = 895 Score = 89.4 bits (220), Expect = 1e-16 Identities = 43/75 (57%), Positives = 57/75 (76%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 +F+++L QW+ D+IVWT+L+DGLL+EG SD+C KF ++MESR CT S T +ILA ELS Sbjct: 814 IFQSLLKKQWNSDLIVWTVLVDGLLQEGDSDLCMKFLYLMESRNCTPSLHTYIILARELS 873 Query: 575 KGDKSIETDCIADGL 531 K KSI TD I + L Sbjct: 874 KVGKSIGTDQIGNRL 888 >KDO58425.1 hypothetical protein CISIN_1g002387mg [Citrus sinensis] Length = 929 Score = 89.0 bits (219), Expect = 2e-16 Identities = 41/68 (60%), Positives = 54/68 (79%) Frame = -3 Query: 752 FENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELSK 573 FE++L QW+ D IVWT+L+DGL+ +G D+C KF HIMESR C+++ QT +ILA ELSK Sbjct: 839 FESMLDKQWNTDEIVWTVLVDGLVTKGLPDLCLKFLHIMESRNCSINLQTYVILANELSK 898 Query: 572 GDKSIETD 549 DKSI+TD Sbjct: 899 VDKSIDTD 906 >XP_008809556.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Phoenix dactylifera] Length = 902 Score = 88.6 bits (218), Expect = 2e-16 Identities = 43/73 (58%), Positives = 54/73 (73%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 +FEN+LL W+PD IVWTILIDGLLK+GK D+C KF HIME++ + QT +ILA E+S Sbjct: 826 IFENMLLQHWNPDEIVWTILIDGLLKDGKPDLCMKFLHIMEAKNYKPTFQTYVILAREVS 885 Query: 575 KGDKSIETDCIAD 537 K +K IE I D Sbjct: 886 KEEKCIEMGLIGD 898 >XP_006447755.1 hypothetical protein CICLE_v10014182mg [Citrus clementina] XP_006469511.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Citrus sinensis] ESR60995.1 hypothetical protein CICLE_v10014182mg [Citrus clementina] Length = 929 Score = 88.2 bits (217), Expect = 3e-16 Identities = 41/68 (60%), Positives = 53/68 (77%) Frame = -3 Query: 752 FENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELSK 573 FE++L QW+ D IVWT+L+DGL+ +G D+C KF HIMESR C ++ QT +ILA ELSK Sbjct: 839 FESMLDKQWNTDEIVWTVLVDGLVTKGLPDLCLKFLHIMESRNCCINLQTYVILANELSK 898 Query: 572 GDKSIETD 549 DKSI+TD Sbjct: 899 VDKSIDTD 906 >XP_018852148.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Juglans regia] XP_018852149.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Juglans regia] XP_018852150.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Juglans regia] XP_018852151.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Juglans regia] XP_018852153.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Juglans regia] XP_018852154.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Juglans regia] Length = 1065 Score = 88.2 bits (217), Expect = 3e-16 Identities = 45/74 (60%), Positives = 55/74 (74%) Frame = -3 Query: 752 FENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELSK 573 F+++L W+ D IVWT+L+DGLLKEG+ D C K HIME+R C L+S T LILA ELSK Sbjct: 989 FKSMLEKGWNNDEIVWTVLVDGLLKEGQVDPCMKLLHIMEARNCILNSYTYLILARELSK 1048 Query: 572 GDKSIETDCIADGL 531 DKSIET I+D L Sbjct: 1049 LDKSIETSEISDKL 1062 >ERN18345.1 hypothetical protein AMTR_s00055p00197790 [Amborella trichopoda] Length = 940 Score = 87.8 bits (216), Expect = 4e-16 Identities = 40/73 (54%), Positives = 55/73 (75%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LF N+L QW+P+ ++WT+LIDGLLKEG S++C KF H ME + CT + QT +ILA E+S Sbjct: 858 LFNNMLGAQWNPNEVIWTVLIDGLLKEGNSEMCLKFLHEMEEKGCTPNFQTYVILAREMS 917 Query: 575 KGDKSIETDCIAD 537 K DK ET+ +A+ Sbjct: 918 KEDKLPETELLAN 930 >XP_006856878.2 PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Amborella trichopoda] Length = 952 Score = 87.8 bits (216), Expect = 4e-16 Identities = 40/73 (54%), Positives = 55/73 (75%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LF N+L QW+P+ ++WT+LIDGLLKEG S++C KF H ME + CT + QT +ILA E+S Sbjct: 870 LFNNMLGAQWNPNEVIWTVLIDGLLKEGNSEMCLKFLHEMEEKGCTPNFQTYVILAREMS 929 Query: 575 KGDKSIETDCIAD 537 K DK ET+ +A+ Sbjct: 930 KEDKLPETELLAN 942 >OAY34974.1 hypothetical protein MANES_12G061200 [Manihot esculenta] Length = 647 Score = 87.4 bits (215), Expect = 5e-16 Identities = 44/72 (61%), Positives = 54/72 (75%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LF ++L +W+ D+IVWT+LIDGLL EG+SDVC KF H+MESR C LS T L LA ELS Sbjct: 566 LFHSLLEEKWNSDLIVWTVLIDGLLHEGQSDVCMKFLHLMESRNCALSLYTYLSLARELS 625 Query: 575 KGDKSIETDCIA 540 K KS ET+ I+ Sbjct: 626 KVRKSSETNKIS 637 >OAY34973.1 hypothetical protein MANES_12G061200 [Manihot esculenta] Length = 912 Score = 87.4 bits (215), Expect = 6e-16 Identities = 44/72 (61%), Positives = 54/72 (75%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LF ++L +W+ D+IVWT+LIDGLL EG+SDVC KF H+MESR C LS T L LA ELS Sbjct: 831 LFHSLLEEKWNSDLIVWTVLIDGLLHEGQSDVCMKFLHLMESRNCALSLYTYLSLARELS 890 Query: 575 KGDKSIETDCIA 540 K KS ET+ I+ Sbjct: 891 KVRKSSETNKIS 902 >XP_012081436.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Jatropha curcas] XP_012081437.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Jatropha curcas] XP_012081438.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Jatropha curcas] KDP29910.1 hypothetical protein JCGZ_18479 [Jatropha curcas] Length = 909 Score = 86.7 bits (213), Expect = 1e-15 Identities = 41/71 (57%), Positives = 53/71 (74%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 +F+ +L +W+ D+IVW +L+DGLL+EG+SDVC KF +MESR CT S T ILA ELS Sbjct: 828 IFQRLLEKKWNSDIIVWAVLVDGLLQEGQSDVCMKFLSLMESRNCTPSLHTYEILARELS 887 Query: 575 KGDKSIETDCI 543 K KS+ETD I Sbjct: 888 KAGKSLETDKI 898 >XP_010943853.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Elaeis guineensis] Length = 898 Score = 86.3 bits (212), Expect = 1e-15 Identities = 41/73 (56%), Positives = 53/73 (72%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 +FEN+LL W+PD IVWTILIDGLLK+GK D+C KF HIME++ + QT +ILA E+S Sbjct: 822 IFENMLLQHWNPDEIVWTILIDGLLKDGKPDLCMKFLHIMEAKDYKPTFQTYVILAREVS 881 Query: 575 KGDKSIETDCIAD 537 K + IE + D Sbjct: 882 KEENCIEMSLVGD 894 >XP_017190183.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Malus domestica] Length = 914 Score = 85.9 bits (211), Expect = 2e-15 Identities = 40/73 (54%), Positives = 55/73 (75%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LF +L QW+ D IVWT+LIDGLLKEG SD+C KF H++ES C++S+QT +ILA ELS Sbjct: 835 LFRRMLEKQWNTDEIVWTVLIDGLLKEGNSDLCMKFLHVIESEKCSISTQTYVILARELS 894 Query: 575 KGDKSIETDCIAD 537 K ++++ T I + Sbjct: 895 KINETVVTSQIVN 907 >XP_019198545.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Ipomoea nil] Length = 930 Score = 85.9 bits (211), Expect = 2e-15 Identities = 43/73 (58%), Positives = 55/73 (75%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LF ++L QW+ D IVWTILIDGLLKEG+S++C K H MES+ C ++ Q+ LILA ELS Sbjct: 849 LFISMLERQWNSDEIVWTILIDGLLKEGESEMCMKLLHAMESKNCPINLQSYLILARELS 908 Query: 575 KGDKSIETDCIAD 537 K DKSI+ IA+ Sbjct: 909 KADKSIDAREIAN 921 >XP_009365209.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] XP_009365210.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] Length = 919 Score = 85.5 bits (210), Expect = 3e-15 Identities = 40/73 (54%), Positives = 54/73 (73%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LF +L QW+ D IVWT+LIDGLLKEG SD+C KF H++ES C++S+QT +ILA ELS Sbjct: 840 LFRRMLEKQWNTDEIVWTVLIDGLLKEGNSDLCMKFLHVIESEKCSISTQTYVILARELS 899 Query: 575 KGDKSIETDCIAD 537 K + ++ T I + Sbjct: 900 KINNTVVTSQIVN 912 >XP_016443250.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X3 [Nicotiana tabacum] Length = 662 Score = 84.3 bits (207), Expect = 6e-15 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LFEN+L QW+ D IVWTILIDGLLKE +S++C K H+MES+ CT+S QT +ILA ELS Sbjct: 599 LFENMLGKQWNSDEIVWTILIDGLLKERESELCMKLLHVMESKSCTISFQTYVILARELS 658 Query: 575 KGD 567 K D Sbjct: 659 KLD 661 >XP_009767096.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X3 [Nicotiana sylvestris] Length = 662 Score = 84.3 bits (207), Expect = 6e-15 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = -3 Query: 755 LFENILLGQWSPDVIVWTILIDGLLKEGKSDVCAKFFHIMESRYCTLSSQTSLILAGELS 576 LFEN+L QW+ D IVWTILIDGLLKE +S++C K H+MES+ CT+S QT +ILA ELS Sbjct: 599 LFENMLGKQWNSDEIVWTILIDGLLKERESELCMKLLHVMESKSCTISFQTYVILARELS 658 Query: 575 KGD 567 K D Sbjct: 659 KLD 661