BLASTX nr result
ID: Papaver32_contig00042073
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00042073 (688 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010271780.1 PREDICTED: pentatricopeptide repeat-containing pr... 50 3e-07 XP_010537961.1 PREDICTED: pentatricopeptide repeat-containing pr... 51 1e-06 ONK63646.1 uncharacterized protein A4U43_C07F17420 [Asparagus of... 51 1e-06 OAY68463.1 Pentatricopeptide repeat-containing protein, mitochon... 50 5e-06 XP_007028355.2 PREDICTED: pentatricopeptide repeat-containing pr... 50 5e-06 XP_019163006.1 PREDICTED: pentatricopeptide repeat-containing pr... 50 5e-06 JAU88217.1 Pentatricopeptide repeat-containing protein, mitochon... 52 5e-06 XP_020103543.1 pentatricopeptide repeat-containing protein At1g8... 50 5e-06 XP_020080956.1 pentatricopeptide repeat-containing protein At1g8... 50 5e-06 EOY08857.1 Pentatricopeptide repeat-containing protein isoform 1... 50 6e-06 EOY08858.1 Pentatricopeptide repeat-containing protein isoform 2... 50 6e-06 XP_018446300.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 8e-06 NP_178143.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] ... 51 8e-06 XP_008778136.2 PREDICTED: pentatricopeptide repeat-containing pr... 49 8e-06 BAD95295.1 hypothetical protein, partial [Arabidopsis thaliana] 51 8e-06 XP_008786836.1 PREDICTED: pentatricopeptide repeat-containing pr... 49 1e-05 XP_017623237.1 PREDICTED: pentatricopeptide repeat-containing pr... 50 1e-05 XP_016707608.1 PREDICTED: pentatricopeptide repeat-containing pr... 50 1e-05 XP_011079070.1 PREDICTED: pentatricopeptide repeat-containing pr... 47 1e-05 XP_018818362.1 PREDICTED: pentatricopeptide repeat-containing pr... 47 1e-05 >XP_010271780.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Nelumbo nucifera] Length = 624 Score = 50.1 bits (118), Expect(2) = 3e-07 Identities = 26/66 (39%), Positives = 39/66 (59%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMASA 499 AAISA+ K+G++E+AE +FE + Y+ L+ VY K+LAK + L KRM + Sbjct: 433 AAISAWGKLGKIEEAESVFEMMTKKWKKVHRRCYSLLLKVYADHKMLAKGKELAKRMIDS 492 Query: 498 SRPIDS 481 ID+ Sbjct: 493 GCRIDA 498 Score = 32.7 bits (73), Expect(2) = 3e-07 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQ 369 LVKLC+ AGE EKADS+ LQK +Q Sbjct: 504 LVKLCVEAGEVEKADSI--LQKATQQ 527 >XP_010537961.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Tarenaya hassleriana] XP_010537962.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Tarenaya hassleriana] Length = 600 Score = 51.2 bits (121), Expect(2) = 1e-06 Identities = 27/61 (44%), Positives = 40/61 (65%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 D AA+ AF K+ ++++AEEIFE +V+ AL++VYV K+L+K + LVKRM Sbjct: 406 DCIAAVEAFGKLKKIKEAEEIFEKALKLRYKVPSRVFWALLSVYVDHKMLSKGKDLVKRM 465 Query: 507 A 505 A Sbjct: 466 A 466 Score = 29.6 bits (65), Expect(2) = 1e-06 Identities = 20/38 (52%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -3 Query: 476 GFTILGL-FGTLVKLCLAAGEAEKADSVLLLQKDLEQR 366 G T+ GL + LV+L + AGE EKADS LL K +QR Sbjct: 469 GCTVGGLTWDALVRLYVEAGEVEKADS--LLNKAAKQR 504 >ONK63646.1 uncharacterized protein A4U43_C07F17420 [Asparagus officinalis] Length = 653 Score = 50.8 bits (120), Expect(2) = 1e-06 Identities = 27/64 (42%), Positives = 38/64 (59%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMASA 499 +AI A+ ++G+VEKAEE+FE + Y ++ VY KLL+K + LVKRMA Sbjct: 418 SAIEAWGELGKVEKAEEVFELMSKNWSSLSSRYYNCMIKVYAKHKLLSKGKDLVKRMAEK 477 Query: 498 SRPI 487 R I Sbjct: 478 GRKI 481 Score = 29.6 bits (65), Expect(2) = 1e-06 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQRGDLALQKEYSCSYYLDMDD 309 LVKL + AGE EKADS LQK +Q K CSY + +++ Sbjct: 489 LVKLYVGAGEVEKADS--FLQKASQQN----QMKPLYCSYMMLLEN 528 >OAY68463.1 Pentatricopeptide repeat-containing protein, mitochondrial [Ananas comosus] Length = 643 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 27/61 (44%), Positives = 35/61 (57%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 ++ A I A+ K+G VEKAEE FE Y AL+ VY KLL+K + LVKRM Sbjct: 449 EFLAVIEAWGKLGLVEKAEEAFEEVLKKWKKLSSMYYTALLKVYANHKLLSKGKDLVKRM 508 Query: 507 A 505 + Sbjct: 509 S 509 Score = 28.1 bits (61), Expect(2) = 5e-06 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVL 393 LVKL + AGE EKADS+L Sbjct: 523 LVKLYVEAGEVEKADSIL 540 >XP_007028355.2 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial [Theobroma cacao] Length = 627 Score = 50.1 bits (118), Expect(2) = 5e-06 Identities = 26/61 (42%), Positives = 37/61 (60%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 +Y AAI A+ K+ +VE+AE +FE + YA+L+ VY K+L K + LVKRM Sbjct: 433 EYMAAIEAWGKLNKVEEAEAVFEMMLKTWKKLPARYYASLLKVYSNHKMLQKGKDLVKRM 492 Query: 507 A 505 A Sbjct: 493 A 493 Score = 28.5 bits (62), Expect(2) = 5e-06 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQ 369 LVKL + AGE EKADS+ LQK +Q Sbjct: 507 LVKLYVEAGEVEKADSI--LQKACQQ 530 >XP_019163006.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Ipomoea nil] Length = 619 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 28/59 (47%), Positives = 36/59 (61%) Frame = -2 Query: 684 YSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 Y AAI A+ K+ +V+KAE IFE K Y+ L+NVY K+LAK + LVKRM Sbjct: 426 YMAAIEAWGKLKKVDKAEAIFETMLNKYPKMSSKRYSTLLNVYANNKMLAKGKDLVKRM 484 Score = 28.1 bits (61), Expect(2) = 5e-06 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLL 387 LVKL + AGE EKAD+VL + Sbjct: 499 LVKLYIEAGEVEKADTVLAM 518 >JAU88217.1 Pentatricopeptide repeat-containing protein, mitochondrial [Noccaea caerulescens] Length = 615 Score = 51.6 bits (122), Expect(2) = 5e-06 Identities = 28/72 (38%), Positives = 42/72 (58%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMASA 499 +AI AF K+ +V++AE+IFE Y+ L+ VYV K+LAK + LVKRMA + Sbjct: 424 SAIHAFGKLNKVKEAEDIFEKIVKMDRRASSNTYSVLLRVYVDHKMLAKGKDLVKRMAES 483 Query: 498 SRPIDSDRFHYL 463 I++ + L Sbjct: 484 GCRIEASTWDAL 495 Score = 26.9 bits (58), Expect(2) = 5e-06 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVL 393 L+KL + AGE EKADS+L Sbjct: 495 LIKLYVEAGEVEKADSLL 512 >XP_020103543.1 pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Ananas comosus] Length = 615 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 27/61 (44%), Positives = 35/61 (57%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 ++ A I A+ K+G VEKAEE FE Y AL+ VY KLL+K + LVKRM Sbjct: 421 EFLAVIEAWGKLGLVEKAEEAFEEVLKKWKKLSSMYYTALLKVYANHKLLSKGKDLVKRM 480 Query: 507 A 505 + Sbjct: 481 S 481 Score = 28.1 bits (61), Expect(2) = 5e-06 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVL 393 LVKL + AGE EKADS+L Sbjct: 495 LVKLYVEAGEVEKADSIL 512 >XP_020080956.1 pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Ananas comosus] Length = 615 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 27/61 (44%), Positives = 35/61 (57%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 ++ A I A+ K+G VEKAEE FE Y AL+ VY KLL+K + LVKRM Sbjct: 421 EFLAVIEAWGKLGLVEKAEEAFEEVLKKWKKLSSMYYTALLKVYANHKLLSKGKDLVKRM 480 Query: 507 A 505 + Sbjct: 481 S 481 Score = 28.1 bits (61), Expect(2) = 5e-06 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVL 393 LVKL + AGE EKADS+L Sbjct: 495 LVKLYVEAGEVEKADSIL 512 >EOY08857.1 Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 623 Score = 49.7 bits (117), Expect(2) = 6e-06 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 +Y AAI A+ K+ ++E+AE +FE + YA+L+ VY K+L K + LVKRM Sbjct: 429 EYMAAIEAWGKLNKIEEAEAVFEMMLKTWKKLPARYYASLLKVYSNHKMLQKGKDLVKRM 488 Query: 507 A 505 A Sbjct: 489 A 489 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQ 369 LVKL + AGE EKADS+ LQK +Q Sbjct: 503 LVKLYVEAGEVEKADSI--LQKACQQ 526 >EOY08858.1 Pentatricopeptide repeat-containing protein isoform 2, partial [Theobroma cacao] Length = 621 Score = 49.7 bits (117), Expect(2) = 6e-06 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 +Y AAI A+ K+ ++E+AE +FE + YA+L+ VY K+L K + LVKRM Sbjct: 427 EYMAAIEAWGKLNKIEEAEAVFEMMLKTWKKLPARYYASLLKVYSNHKMLQKGKDLVKRM 486 Query: 507 A 505 A Sbjct: 487 A 487 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQ 369 LVKL + AGE EKADS+ LQK +Q Sbjct: 501 LVKLYVEAGEVEKADSI--LQKACQQ 524 >XP_018446300.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial [Raphanus sativus] XP_018446302.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial [Raphanus sativus] XP_018446303.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial [Raphanus sativus] Length = 610 Score = 52.0 bits (123), Expect(2) = 8e-06 Identities = 28/72 (38%), Positives = 42/72 (58%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMASA 499 +AI AF K+ +V++AEEIFE Y+ L+ VYV K+L+K + LVKRMA + Sbjct: 419 SAIHAFGKLNKVQEAEEIFEKIIKMDRRASSNTYSVLLRVYVDHKMLSKGKDLVKRMAES 478 Query: 498 SRPIDSDRFHYL 463 I++ + L Sbjct: 479 GCRIEASTWDAL 490 Score = 25.8 bits (55), Expect(2) = 8e-06 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVL 393 L++L + AGE EKADS+L Sbjct: 490 LIRLYVEAGEVEKADSLL 507 >NP_178143.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] NP_974190.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] NP_001077853.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] NP_001321806.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] NP_001321807.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] Q9C977.1 RecName: Full=Pentatricopeptide repeat-containing protein At1g80270, mitochondrial; Flags: Precursor AAG52431.1 hypothetical protein; 8785-10851 [Arabidopsis thaliana] AAL32603.1 Unknown protein [Arabidopsis thaliana] AAM13306.1 unknown protein [Arabidopsis thaliana] AEE36379.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] AEE36380.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] AEE36381.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] OAP12784.1 PPR596 [Arabidopsis thaliana] ANM59450.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] ANM59451.1 PENTATRICOPEPTIDE REPEAT 596 [Arabidopsis thaliana] Length = 596 Score = 50.8 bits (120), Expect(2) = 8e-06 Identities = 27/66 (40%), Positives = 39/66 (59%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMASA 499 AAI AF K+ +V++AE IFE Y+ L+ VYV K+L+K + LVKRMA + Sbjct: 405 AAIQAFGKLNKVQEAEAIFEKIVKMDRRASSSTYSVLLRVYVDHKMLSKGKDLVKRMAES 464 Query: 498 SRPIDS 481 I++ Sbjct: 465 GCRIEA 470 Score = 26.9 bits (58), Expect(2) = 8e-06 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVL 393 L+KL + AGE EKADS+L Sbjct: 476 LIKLYVEAGEVEKADSLL 493 >XP_008778136.2 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Phoenix dactylifera] Length = 507 Score = 48.5 bits (114), Expect(2) = 8e-06 Identities = 26/58 (44%), Positives = 35/58 (60%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMA 505 AAI A+ K+G++E AEE+FE K Y AL+ VY KLL+K + L KRM+ Sbjct: 316 AAIEAWGKLGQIENAEEVFENMLKTWKRLSSKYYNALLKVYANHKLLSKGKELAKRMS 373 Score = 29.3 bits (64), Expect(2) = 8e-06 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQRGDLALQKEY 339 LVKL + AGE EKADS+ LQK +Q L Y Sbjct: 387 LVKLYVEAGEVEKADSI--LQKAAQQNQIKPLYSSY 420 >BAD95295.1 hypothetical protein, partial [Arabidopsis thaliana] Length = 216 Score = 50.8 bits (120), Expect(2) = 8e-06 Identities = 27/66 (40%), Positives = 39/66 (59%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMASA 499 AAI AF K+ +V++AE IFE Y+ L+ VYV K+L+K + LVKRMA + Sbjct: 25 AAIQAFGKLNKVQEAEAIFEKIVKMDRRASSSTYSVLLRVYVDHKMLSKGKDLVKRMAES 84 Query: 498 SRPIDS 481 I++ Sbjct: 85 GCRIEA 90 Score = 26.9 bits (58), Expect(2) = 8e-06 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVL 393 L+KL + AGE EKADS+L Sbjct: 96 LIKLYVEAGEVEKADSLL 113 >XP_008786836.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Phoenix dactylifera] Length = 626 Score = 48.9 bits (115), Expect(2) = 1e-05 Identities = 27/60 (45%), Positives = 35/60 (58%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMASA 499 AA+ A+ K+G VE AEE+FE K Y AL+ VY KLL+K + L KRM+ A Sbjct: 435 AAVEAWGKLGHVEDAEEVFENMLKTWKNLSSKYYNALLKVYADHKLLSKGKELAKRMSDA 494 Score = 28.5 bits (62), Expect(2) = 1e-05 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQ 369 LVKL + AGE EKADS+ LQK +Q Sbjct: 506 LVKLYVEAGEVEKADSI--LQKAAQQ 529 >XP_017623237.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial [Gossypium arboreum] Length = 624 Score = 50.4 bits (119), Expect(2) = 1e-05 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 +Y A I A+ K+G++EK+EEIFE + Y L+ VY K+L K + LVKRM Sbjct: 430 EYLAGIEAWGKLGKIEKSEEIFERLLKTSKKLPARYYTHLLKVYSNHKMLEKGKDLVKRM 489 Query: 507 A 505 A Sbjct: 490 A 490 Score = 26.9 bits (58), Expect(2) = 1e-05 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQ 369 LVKL + AG+ EKADS+ LQK +Q Sbjct: 504 LVKLHVEAGDVEKADSI--LQKACQQ 527 >XP_016707608.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Gossypium hirsutum] Length = 624 Score = 50.4 bits (119), Expect(2) = 1e-05 Identities = 26/61 (42%), Positives = 36/61 (59%) Frame = -2 Query: 687 DYSAAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 +Y A I A+ K+G++EK+EEIFE + Y L+ VY K+L K + LVKRM Sbjct: 430 EYLAGIEAWGKLGKIEKSEEIFERLLKTSKKLPARYYTHLLKVYSNHKMLEKGKDLVKRM 489 Query: 507 A 505 A Sbjct: 490 A 490 Score = 26.9 bits (58), Expect(2) = 1e-05 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQ 369 LVKL + AG+ EKADS+ LQK +Q Sbjct: 504 LVKLHVEAGDVEKADSI--LQKACQQ 527 >XP_011079070.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial [Sesamum indicum] Length = 621 Score = 47.4 bits (111), Expect(2) = 1e-05 Identities = 26/64 (40%), Positives = 38/64 (59%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRMASA 499 AAI A+ K+ R+E+AE F+ K +A L+NVY K+LAK + LVKR+A + Sbjct: 430 AAIGAWGKLKRIEEAEAAFDKMVKKVKRPSSKHFALLLNVYANHKMLAKGKDLVKRLAES 489 Query: 498 SRPI 487 S + Sbjct: 490 SSTV 493 Score = 30.0 bits (66), Expect(2) = 1e-05 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQRGDLALQKEY 339 LVKL + AGE EKADS+ L K L+Q+ L Y Sbjct: 501 LVKLYVGAGEVEKADSI--LDKALKQKRGKPLFNSY 534 >XP_018818362.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Juglans regia] XP_018818376.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Juglans regia] Length = 614 Score = 47.4 bits (111), Expect(2) = 1e-05 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = -2 Query: 678 AAISAFCKVGRVEKAEEIFEXXXXXXXXXXXKVYAALMNVYVGRKLLAKAEGLVKRM 508 AAI A+ K+G+VE+AE +FE + Y AL+ VYV +KL+ K + VKRM Sbjct: 422 AAIEAWGKLGKVEEAEAVFEIMLQKWKRLSSRQYCALLKVYVDQKLVTKGKEFVKRM 478 Score = 30.0 bits (66), Expect(2) = 1e-05 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = -3 Query: 446 LVKLCLAAGEAEKADSVLLLQKDLEQRGDLALQKEY 339 LV+L L AGE EKADS+ L K +Q D A + Y Sbjct: 493 LVRLFLVAGELEKADSI--LHKATQQNRDRASFRTY 526