BLASTX nr result
ID: Papaver32_contig00041510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00041510 (549 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV58832.1 homeobox-leucine zipper protein ATHB-15 [Dorcoceras h... 56 5e-06 >KZV58832.1 homeobox-leucine zipper protein ATHB-15 [Dorcoceras hygrometricum] Length = 833 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/47 (61%), Positives = 32/47 (68%) Frame = +1 Query: 409 SNGCTGVAA*AFSLVGQEPI*VA*ILKDRPLWLPYLGAVEYATVLPT 549 S+GCTGVAA A LVG EP V ILKDRP+W Y AV+ VLPT Sbjct: 208 SHGCTGVAARACGLVGLEPTRVVEILKDRPMWFRYCRAVDVLNVLPT 254