BLASTX nr result
ID: Papaver32_contig00040914
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00040914 (535 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAR99363.1 hypothetical protein At2g38630 [Arabidopsis thaliana]... 62 4e-08 AAC67355.1 unknown protein [Arabidopsis thaliana] 62 4e-08 OAP09862.1 hypothetical protein AXX17_AT2G35490 [Arabidopsis tha... 62 4e-08 NP_181397.2 Transducin/WD40 repeat-like superfamily protein [Ara... 62 4e-08 OAY44630.1 hypothetical protein MANES_08G167000 [Manihot esculenta] 61 8e-08 XP_013605726.1 PREDICTED: uncharacterized protein LOC106312670 [... 61 8e-08 XP_011006237.1 PREDICTED: uncharacterized protein LOC105112286 [... 61 8e-08 XP_010509150.1 PREDICTED: uncharacterized protein LOC104785599 [... 60 1e-07 XP_010505503.1 PREDICTED: uncharacterized protein LOC104782305 [... 60 1e-07 XP_013742475.1 PREDICTED: uncharacterized protein LOC106445456 [... 60 1e-07 KFK34666.1 hypothetical protein AALP_AA5G175600 [Arabis alpina] 60 1e-07 XP_013637093.1 PREDICTED: uncharacterized protein LOC106342641 [... 60 1e-07 CAB70993.1 putative protein [Arabidopsis thaliana] 60 2e-07 XP_019576607.1 PREDICTED: uncharacterized protein LOC109440882 [... 60 2e-07 NP_566994.1 Transducin/WD40 repeat-like superfamily protein [Ara... 60 2e-07 XP_006403606.1 hypothetical protein EUTSA_v10010345mg [Eutrema s... 60 3e-07 XP_018818531.1 PREDICTED: uncharacterized protein LOC108989270 i... 59 3e-07 XP_018818465.1 PREDICTED: uncharacterized protein LOC108989270 i... 59 4e-07 JAT62413.1 Lissencephaly-1 [Anthurium amnicola] 59 4e-07 XP_018818403.1 PREDICTED: uncharacterized protein LOC108989270 i... 59 4e-07 >AAR99363.1 hypothetical protein At2g38630 [Arabidopsis thaliana] AAV63894.1 hypothetical protein At2g38630 [Arabidopsis thaliana] Length = 405 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK+E+ SS+ R + + AL+ TAL Y+EERNEIYTGN GL+HVWSN Sbjct: 352 PKEEDCSSSDLGNSSRRRSAVAEALEDITALFYDEERNEIYTGNRHGLLHVWSN 405 >AAC67355.1 unknown protein [Arabidopsis thaliana] Length = 466 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK+E+ SS+ R + + AL+ TAL Y+EERNEIYTGN GL+HVWSN Sbjct: 413 PKEEDCSSSDLGNSSRRRSAVAEALEDITALFYDEERNEIYTGNRHGLLHVWSN 466 >OAP09862.1 hypothetical protein AXX17_AT2G35490 [Arabidopsis thaliana] Length = 467 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK+E+ SS+ R + + AL+ TAL Y+EERNEIYTGN GL+HVWSN Sbjct: 414 PKEEDCSSSDLGNSSRRRSAVAEALEDITALFYDEERNEIYTGNRHGLLHVWSN 467 >NP_181397.2 Transducin/WD40 repeat-like superfamily protein [Arabidopsis thaliana] AAO42261.1 unknown protein [Arabidopsis thaliana] AAO63943.1 unknown protein [Arabidopsis thaliana] AEC09559.1 Transducin/WD40 repeat-like superfamily protein [Arabidopsis thaliana] Length = 467 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK+E+ SS+ R + + AL+ TAL Y+EERNEIYTGN GL+HVWSN Sbjct: 414 PKEEDCSSSDLGNSSRRRSAVAEALEDITALFYDEERNEIYTGNRHGLLHVWSN 467 >OAY44630.1 hypothetical protein MANES_08G167000 [Manihot esculenta] Length = 466 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +2 Query: 2 NPK-DENSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 NPK DE S S+ M+ + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 411 NPKGDECSGSTSKQSHSPMRSTVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 466 >XP_013605726.1 PREDICTED: uncharacterized protein LOC106312670 [Brassica oleracea var. oleracea] XP_013605727.1 PREDICTED: uncharacterized protein LOC106312670 [Brassica oleracea var. oleracea] XP_013711863.1 PREDICTED: uncharacterized protein LOC106415654 [Brassica napus] XP_013711864.1 PREDICTED: uncharacterized protein LOC106415654 [Brassica napus] Length = 468 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/57 (54%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKR---LYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK++ S SS S K+R + AL+ TAL Y+EERNEIYTGN G VHVWSN Sbjct: 412 PKEDESSSSSSSLGNNSKQRRNAVAEALEDITALFYDEERNEIYTGNRHGFVHVWSN 468 >XP_011006237.1 PREDICTED: uncharacterized protein LOC105112286 [Populus euphratica] Length = 474 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +2 Query: 2 NPKDEN-SDSSESPFPGR--MKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 +PKDE S S+ S R M+ + +ALK TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 417 SPKDEECSSSAGSSKQSRLMMRSTVAAALKDITALFYDEERNEIYTGNRHGLVHVWSN 474 >XP_010509150.1 PREDICTED: uncharacterized protein LOC104785599 [Camelina sativa] Length = 466 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK+E+S SS+ + + + AL+ TAL Y+EERNEIYTGN GL+HVWSN Sbjct: 413 PKEEDSSSSDLGNSMQRRSVVAEALEDITALFYDEERNEIYTGNRHGLLHVWSN 466 >XP_010505503.1 PREDICTED: uncharacterized protein LOC104782305 [Camelina sativa] Length = 466 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK+E+S SS+ + + + AL+ TAL Y+EERNEIYTGN GL+HVWSN Sbjct: 413 PKEEDSSSSDLGNSMQRRSVVAEALEDITALFYDEERNEIYTGNRHGLLHVWSN 466 >XP_013742475.1 PREDICTED: uncharacterized protein LOC106445456 [Brassica napus] Length = 469 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/57 (54%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKR---LYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK++ S SS S K+R + AL+ TAL Y+EERNEIYTGN G VHVWSN Sbjct: 413 PKEDESSSSSSSLGTNSKQRRNAVAEALEDITALFYDEERNEIYTGNRHGFVHVWSN 469 >KFK34666.1 hypothetical protein AALP_AA5G175600 [Arabis alpina] Length = 469 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKR---LYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PKD+ S SS+ K+R + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 413 PKDDESSSSDLGKGKNSKQRRNAVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 469 >XP_013637093.1 PREDICTED: uncharacterized protein LOC106342641 [Brassica oleracea var. oleracea] Length = 470 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 3/56 (5%) Frame = +2 Query: 8 KDENSDSSESPFPGRMKKR---LYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 +DE+S SS S +K+R + AL+ TAL Y+EERNEIYTGN G VHVWSN Sbjct: 415 EDESSSSSSSSLGTNLKQRRNAVAEALEDITALFYDEERNEIYTGNRHGFVHVWSN 470 >CAB70993.1 putative protein [Arabidopsis thaliana] Length = 454 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKR--LYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PKD+ S SS ++R + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 399 PKDDESSSSNCMGKNSKQRRNAVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 454 >XP_019576607.1 PREDICTED: uncharacterized protein LOC109440882 [Rhinolophus sinicus] Length = 467 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKR--LYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PK++ S SS S ++R + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 412 PKEDESSSSSSLGTNSKQRRNAVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 467 >NP_566994.1 Transducin/WD40 repeat-like superfamily protein [Arabidopsis thaliana] AAK25973.1 unknown protein [Arabidopsis thaliana] AAL16275.1 AT3g54190/F24B22_150 [Arabidopsis thaliana] AAK64134.1 unknown protein [Arabidopsis thaliana] AEE79197.1 Transducin/WD40 repeat-like superfamily protein [Arabidopsis thaliana] OAP07041.1 hypothetical protein AXX17_AT3G48620 [Arabidopsis thaliana] Length = 467 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKR--LYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 PKD+ S SS ++R + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 412 PKDDESSSSNCMGKNSKQRRNAVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 467 >XP_006403606.1 hypothetical protein EUTSA_v10010345mg [Eutrema salsugineum] ESQ45059.1 hypothetical protein EUTSA_v10010345mg [Eutrema salsugineum] Length = 467 Score = 59.7 bits (143), Expect = 3e-07 Identities = 32/57 (56%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = +2 Query: 5 PKDENSDSSESPFPGRMKKR---LYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 P E+ SS S F K+R + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 411 PPKEDESSSSSCFGKSSKQRRNAVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 467 >XP_018818531.1 PREDICTED: uncharacterized protein LOC108989270 isoform X3 [Juglans regia] Length = 414 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = +2 Query: 17 NSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 ++ SS+ P R++ + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 365 SAGSSKQPDHYRVRSTVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 414 >XP_018818465.1 PREDICTED: uncharacterized protein LOC108989270 isoform X2 [Juglans regia] Length = 441 Score = 59.3 bits (142), Expect = 4e-07 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = +2 Query: 17 NSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 ++ SS+ P R++ + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 392 SAGSSKQPDHYRVRSTVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 441 >JAT62413.1 Lissencephaly-1 [Anthurium amnicola] Length = 456 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +2 Query: 20 SDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 S+S F + + + AL+ TAL Y+E+RNEIYTGN QGLVHVWSN Sbjct: 408 SNSKREIFASKFRNTVAEALEDITALYYDEDRNEIYTGNRQGLVHVWSN 456 >XP_018818403.1 PREDICTED: uncharacterized protein LOC108989270 isoform X1 [Juglans regia] Length = 468 Score = 59.3 bits (142), Expect = 4e-07 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = +2 Query: 17 NSDSSESPFPGRMKKRLYSALKGTTALSYNEERNEIYTGNEQGLVHVWSN 166 ++ SS+ P R++ + AL+ TAL Y+EERNEIYTGN GLVHVWSN Sbjct: 419 SAGSSKQPDHYRVRSTVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN 468