BLASTX nr result
ID: Papaver32_contig00040831
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00040831 (476 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO93294.1 Glycoside hydrolase, family 17 [Corchorus olitorius] 100 2e-22 OMO77324.1 Glycoside hydrolase, family 17 [Corchorus capsularis] 99 3e-22 XP_018812191.1 PREDICTED: putative glucan endo-1,3-beta-glucosid... 99 1e-21 XP_018812190.1 PREDICTED: putative glucan endo-1,3-beta-glucosid... 99 1e-21 XP_010096970.1 Putative glucan endo-1,3-beta-glucosidase GVI [Mo... 93 4e-21 XP_017972641.1 PREDICTED: putative glucan endo-1,3-beta-glucosid... 95 2e-20 EOY25133.1 Glycosyl hydrolase superfamily protein, putative [The... 94 6e-20 XP_010277204.1 PREDICTED: putative glucan endo-1,3-beta-glucosid... 92 4e-19 XP_010663377.1 PREDICTED: putative glucan endo-1,3-beta-glucosid... 90 2e-18 KVG36939.1 Glycoside hydrolase, catalytic domain-containing prot... 87 1e-17 KVH99895.1 Glycoside hydrolase, catalytic domain-containing prot... 87 3e-17 ONK63453.1 uncharacterized protein A4U43_C07F15310 [Asparagus of... 87 3e-17 AAL30420.1 glucanase [Sambucus nigra] 87 3e-17 CDP14183.1 unnamed protein product [Coffea canephora] 86 4e-17 CDP14182.1 unnamed protein product [Coffea canephora] 87 4e-17 CDP14179.1 unnamed protein product [Coffea canephora] 85 1e-16 AAQ90286.1 beta-1,3-glucanase, basic [Coffea arabica x Coffea ca... 85 1e-16 ONK67524.1 uncharacterized protein A4U43_C05F940 [Asparagus offi... 84 2e-16 pir||D38257 glucan endo-1,3-beta-D-glucosidase (EC 3.2.1.39), ac... 80 5e-16 GAU16327.1 hypothetical protein TSUD_116760 [Trifolium subterran... 78 5e-16 >OMO93294.1 Glycoside hydrolase, family 17 [Corchorus olitorius] Length = 308 Score = 100 bits (248), Expect = 2e-22 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG +VDIV++ESGWPS +NG+IATI N TY N LI+HV GTSGTPKRPGRSIETY+ Sbjct: 215 EKVGGNSVDIVVSESGWPSKENGEIATIGNAETYNNKLIAHVYGTSGTPKRPGRSIETYV 274 Query: 182 F 184 F Sbjct: 275 F 275 >OMO77324.1 Glycoside hydrolase, family 17 [Corchorus capsularis] Length = 306 Score = 99.4 bits (246), Expect = 3e-22 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG +V IV++ESGWPS +NG+IATI N TY NNLI+HV GTSGTPKRPGRSIETY+ Sbjct: 215 EKVGGNSVVIVVSESGWPSKENGEIATIENAETYNNNLIAHVYGTSGTPKRPGRSIETYV 274 Query: 182 F 184 F Sbjct: 275 F 275 >XP_018812191.1 PREDICTED: putative glucan endo-1,3-beta-glucosidase GVI isoform X2 [Juglans regia] Length = 342 Score = 98.6 bits (244), Expect = 1e-21 Identities = 43/61 (70%), Positives = 54/61 (88%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG ++ IV++ESGWPS +NGDIAT+ N + YVNNLI+HVSG +GTPKRPG+SIE+YI Sbjct: 249 EKVGGASIQIVVSESGWPSKENGDIATVANAQMYVNNLIAHVSGETGTPKRPGKSIESYI 308 Query: 182 F 184 F Sbjct: 309 F 309 >XP_018812190.1 PREDICTED: putative glucan endo-1,3-beta-glucosidase GVI isoform X1 [Juglans regia] Length = 346 Score = 98.6 bits (244), Expect = 1e-21 Identities = 43/61 (70%), Positives = 54/61 (88%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG ++ IV++ESGWPS +NGDIAT+ N + YVNNLI+HVSG +GTPKRPG+SIE+YI Sbjct: 253 EKVGGASIQIVVSESGWPSKENGDIATVANAQMYVNNLIAHVSGETGTPKRPGKSIESYI 312 Query: 182 F 184 F Sbjct: 313 F 313 >XP_010096970.1 Putative glucan endo-1,3-beta-glucosidase GVI [Morus notabilis] EXB66547.1 Putative glucan endo-1,3-beta-glucosidase GVI [Morus notabilis] Length = 163 Score = 93.2 bits (230), Expect = 4e-21 Identities = 42/61 (68%), Positives = 50/61 (81%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG +V+IV+AESGWPS NGDIAT+ N + Y NNLI HV G SGTP+RPG+SIE Y+ Sbjct: 69 EKVGGGSVEIVVAESGWPSKGNGDIATVENAKMYNNNLIRHVLGNSGTPRRPGKSIEAYV 128 Query: 182 F 184 F Sbjct: 129 F 129 >XP_017972641.1 PREDICTED: putative glucan endo-1,3-beta-glucosidase GVI [Theobroma cacao] Length = 341 Score = 95.1 bits (235), Expect = 2e-20 Identities = 43/61 (70%), Positives = 52/61 (85%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG +V IV++ESGWPS +NG+IATI N + Y N LI+HVSG SGTPKRPGRSI+TY+ Sbjct: 248 EKVGGNSVVIVVSESGWPSNENGEIATIANAQMYNNKLIAHVSGASGTPKRPGRSIDTYV 307 Query: 182 F 184 F Sbjct: 308 F 308 >EOY25133.1 Glycosyl hydrolase superfamily protein, putative [Theobroma cacao] Length = 341 Score = 94.0 bits (232), Expect = 6e-20 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG V IV++ESGWPS +NG+IATI N + Y N LI+HVSG SGTPKRPGRSI+TY+ Sbjct: 248 EKVGGNYVVIVVSESGWPSNENGEIATIANAQMYNNKLIAHVSGASGTPKRPGRSIDTYV 307 Query: 182 F 184 F Sbjct: 308 F 308 >XP_010277204.1 PREDICTED: putative glucan endo-1,3-beta-glucosidase GVI [Nelumbo nucifera] Length = 338 Score = 91.7 bits (226), Expect = 4e-19 Identities = 38/61 (62%), Positives = 51/61 (83%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EK GG NV++V++E+GWPS NG+IAT N R+Y+NNLI HVS SGTP+RPG+++ETY+ Sbjct: 246 EKAGGPNVEVVVSETGWPSAGNGNIATTANARSYINNLIGHVSAGSGTPRRPGKALETYL 305 Query: 182 F 184 F Sbjct: 306 F 306 >XP_010663377.1 PREDICTED: putative glucan endo-1,3-beta-glucosidase GVI [Vitis vinifera] CBI33865.3 unnamed protein product, partial [Vitis vinifera] Length = 342 Score = 89.7 bits (221), Expect = 2e-18 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EK GG +V +V+ ESGWPS +NG IATI N R Y NNL++H+SG GTPK+PG SIE Y+ Sbjct: 249 EKAGGASVKVVVTESGWPSNENGQIATIENARMYNNNLVAHLSGAKGTPKKPGESIEAYV 308 Query: 182 F 184 F Sbjct: 309 F 309 >KVG36939.1 Glycoside hydrolase, catalytic domain-containing protein [Cynara cardunculus var. scolymus] Length = 284 Score = 86.7 bits (213), Expect = 1e-17 Identities = 37/59 (62%), Positives = 48/59 (81%) Frame = +2 Query: 8 VGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYIF 184 +GG +V+IV++ESGWPS +AT+ N +TY NNLI HV GT+GTP++PGRSIETYIF Sbjct: 193 LGGEDVEIVVSESGWPSAGGDPVATVENAKTYNNNLIQHVKGTNGTPRKPGRSIETYIF 251 >KVH99895.1 Glycoside hydrolase, catalytic domain-containing protein [Cynara cardunculus var. scolymus] Length = 335 Score = 86.7 bits (213), Expect = 3e-17 Identities = 37/59 (62%), Positives = 48/59 (81%) Frame = +2 Query: 8 VGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYIF 184 +GG +V+IV++ESGWPS +AT+ N +TY NNLI HV GT+GTP++PGRSIETYIF Sbjct: 244 LGGEDVEIVVSESGWPSAGGDPVATVENAKTYNNNLIQHVKGTNGTPRKPGRSIETYIF 302 >ONK63453.1 uncharacterized protein A4U43_C07F15310 [Asparagus officinalis] Length = 336 Score = 86.7 bits (213), Expect = 3e-17 Identities = 37/61 (60%), Positives = 49/61 (80%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG NVDIV++E+GWPSG NG ATI N + Y NN+++H+ +GTPK+PG+ IETY+ Sbjct: 243 EKVGGSNVDIVVSETGWPSGGNGLGATIENAKIYNNNVVAHIEKNAGTPKKPGKKIETYL 302 Query: 182 F 184 F Sbjct: 303 F 303 >AAL30420.1 glucanase [Sambucus nigra] Length = 340 Score = 86.7 bits (213), Expect = 3e-17 Identities = 41/61 (67%), Positives = 48/61 (78%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EK GG NV+IV++ESGWP+ Q +ATI N +TY NNLI HV G SGTP+RPGR IETYI Sbjct: 249 EKAGGPNVEIVVSESGWPT-QGHPVATIDNAKTYNNNLIRHVKGRSGTPRRPGRDIETYI 307 Query: 182 F 184 F Sbjct: 308 F 308 >CDP14183.1 unnamed protein product [Coffea canephora] Length = 343 Score = 86.3 bits (212), Expect = 4e-17 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 E+ GG +V+IV++E+GWPS G +I N RTY NLI HV+G SGTPKRPGR+IETYI Sbjct: 252 ERAGGQSVEIVVSETGWPSDGGGQATSIDNARTYNTNLIGHVNGNSGTPKRPGRAIETYI 311 Query: 182 F 184 F Sbjct: 312 F 312 >CDP14182.1 unnamed protein product [Coffea canephora] Length = 391 Score = 86.7 bits (213), Expect = 4e-17 Identities = 37/61 (60%), Positives = 49/61 (80%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 E+ GG +V+IV++E+GWPS G +I N RTY NNLI HV+G+SGTP+RPG++IETYI Sbjct: 285 ERAGGSSVEIVVSETGWPSAGGGQATSIDNARTYNNNLIKHVNGSSGTPRRPGKAIETYI 344 Query: 182 F 184 F Sbjct: 345 F 345 >CDP14179.1 unnamed protein product [Coffea canephora] Length = 343 Score = 85.1 bits (209), Expect = 1e-16 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EK GG +V IV++E+GWPS G +I N RTY NNLI HV+G SGTPKRPGR+IETYI Sbjct: 253 EKAGGSSVQIVVSETGWPSA-GGQATSIDNARTYNNNLIKHVNGNSGTPKRPGRAIETYI 311 Query: 182 F 184 F Sbjct: 312 F 312 >AAQ90286.1 beta-1,3-glucanase, basic [Coffea arabica x Coffea canephora] Length = 343 Score = 85.1 bits (209), Expect = 1e-16 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EK GG +V IV++E+GWPS G +I N RTY NNLI HV+G SGTPKRPGR+IETYI Sbjct: 253 EKAGGSSVQIVVSETGWPSA-GGQATSIDNARTYNNNLIKHVNGNSGTPKRPGRAIETYI 311 Query: 182 F 184 F Sbjct: 312 F 312 >ONK67524.1 uncharacterized protein A4U43_C05F940 [Asparagus officinalis] Length = 318 Score = 84.0 bits (206), Expect = 2e-16 Identities = 35/61 (57%), Positives = 47/61 (77%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EK+GG NV+++++E+GWPSG N ATI N Y NNL+ HV+G +GTPKRPG+ ETY+ Sbjct: 227 EKMGGSNVEVIVSETGWPSGGNERGATIDNAMAYNNNLVKHVNGNAGTPKRPGKGTETYL 286 Query: 182 F 184 F Sbjct: 287 F 287 >pir||D38257 glucan endo-1,3-beta-D-glucosidase (EC 3.2.1.39), acidic (clone cI30) - common tobacco (cv. Samsun NN) (fragment) Length = 162 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/61 (59%), Positives = 47/61 (77%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EK GG NV+I+++ESGWPS N ATI N +TY NLI+HV +GTPK+PG++IETY+ Sbjct: 70 EKAGGQNVEIIVSESGWPSEGNS-AATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYL 128 Query: 182 F 184 F Sbjct: 129 F 129 >GAU16327.1 hypothetical protein TSUD_116760 [Trifolium subterraneum] Length = 98 Score = 78.2 bits (191), Expect = 5e-16 Identities = 37/61 (60%), Positives = 43/61 (70%) Frame = +2 Query: 2 EKVGGYNVDIVIAESGWPSGQNGDIATIPNTRTYVNNLISHVSGTSGTPKRPGRSIETYI 181 EKVGG NV I+++ESGWPS G AT N Y NLISHV +GTPKRPG +IETY+ Sbjct: 6 EKVGGSNVKIIVSESGWPSAGEGS-ATTDNAAAYYTNLISHVKSGNGTPKRPGEAIETYL 64 Query: 182 F 184 F Sbjct: 65 F 65