BLASTX nr result
ID: Papaver32_contig00039784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00039784 (402 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008800515.1 PREDICTED: 1-phosphatidylinositol-3-phosphate 5-k... 54 1e-05 >XP_008800515.1 PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like [Phoenix dactylifera] Length = 1837 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/59 (45%), Positives = 39/59 (66%), Gaps = 9/59 (15%) Frame = -1 Query: 150 LNDYKLVYVQSFYEFECQGGSR---------*IVPSYDNEATSINAHALVPKDYYVQMS 1 LN+YK VYV F E ECQGG+R ++P YD+E T+I ++ALV +Y++Q+S Sbjct: 1399 LNEYKPVYVPLFRELECQGGARFLLPVGVNDTVIPIYDDEPTTIISYALVSPEYHIQIS 1457