BLASTX nr result
ID: Papaver32_contig00039487
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00039487 (446 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU15462.1 hypothetical protein TSUD_44990 [Trifolium subterraneum] 53 9e-06 >GAU15462.1 hypothetical protein TSUD_44990 [Trifolium subterraneum] Length = 159 Score = 52.8 bits (125), Expect = 9e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 193 ELPSMDATQNGNNLSNLGQIYNREDHSTKVLMATK 89 +LPS DA Q NNLSNLGQIYNRED ST VL+ TK Sbjct: 112 DLPSADANQIANNLSNLGQIYNREDSSTDVLVWTK 146