BLASTX nr result
ID: Papaver32_contig00039452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00039452 (480 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACJ76786.1 tyrosinase polyphenol oxidase [Argemone mexicana] 56 3e-06 >ACJ76786.1 tyrosinase polyphenol oxidase [Argemone mexicana] Length = 589 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/62 (46%), Positives = 36/62 (58%) Frame = -2 Query: 197 MEAKRWXXXXXXXXXXXXXXXSDLFVQDSDQQVQAISFISDLKATVLGFFDGTWLTTEDA 18 ME KRW DLF+ DS QQ++ ISFI DLK T+LG FDGTW++ E Sbjct: 1 METKRWVSLIFLAFILLVLSS-DLFLTDSQQQMKPISFIRDLKKTILGIFDGTWVSMETT 59 Query: 17 SA 12 S+ Sbjct: 60 SS 61