BLASTX nr result
ID: Papaver32_contig00039044
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00039044 (437 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009595268.1 PREDICTED: ribonucleoside-diphosphate reductase l... 87 9e-25 NP_001313147.1 ribonucleoside-diphosphate reductase large subuni... 87 9e-25 XP_019179550.1 PREDICTED: ribonucleoside-diphosphate reductase l... 87 1e-24 XP_019179548.1 PREDICTED: ribonucleoside-diphosphate reductase l... 87 3e-24 XP_004288327.1 PREDICTED: ribonucleoside-diphosphate reductase l... 87 3e-24 XP_019179549.1 PREDICTED: ribonucleoside-diphosphate reductase l... 87 3e-24 XP_015583930.1 PREDICTED: ribonucleoside-diphosphate reductase l... 86 3e-24 OAY35986.1 hypothetical protein MANES_12G146100 [Manihot esculenta] 86 3e-24 XP_009372719.1 PREDICTED: ribonucleoside-diphosphate reductase l... 87 3e-24 XP_008338765.1 PREDICTED: ribonucleoside-diphosphate reductase l... 87 3e-24 GAV84480.1 Ribonuc_red_lgN domain-containing protein/Ribonuc_red... 87 3e-24 EEF28063.1 ribonucleoside-diphosphate reductase large chain, put... 86 3e-24 XP_019260593.1 PREDICTED: ribonucleoside-diphosphate reductase l... 86 4e-24 XP_010261001.1 PREDICTED: ribonucleoside-diphosphate reductase l... 86 4e-24 XP_015071402.1 PREDICTED: ribonucleoside-diphosphate reductase l... 85 4e-24 XP_012571595.1 PREDICTED: ribonucleoside-diphosphate reductase l... 87 4e-24 XP_011090447.1 PREDICTED: ribonucleoside-diphosphate reductase l... 86 5e-24 XP_011090448.1 PREDICTED: ribonucleoside-diphosphate reductase l... 86 5e-24 XP_012572237.1 PREDICTED: ribonucleoside-diphosphate reductase l... 86 7e-24 XP_020089354.1 ribonucleoside-diphosphate reductase large subuni... 85 7e-24 >XP_009595268.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Nicotiana tomentosiformis] Length = 808 Score = 87.4 bits (215), Expect(3) = 9e-25 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLK+QGKVVERP HMLM V VGIHKD+IESV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKIQGKVVERPQHMLMRVSVGIHKDDIESVIKT 189 Score = 47.0 bits (110), Expect(3) = 9e-25 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I ++ K ++L+SQRWFTHASPTLFNAGT Sbjct: 183 IESVIKTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 9e-25 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >NP_001313147.1 ribonucleoside-diphosphate reductase large subunit [Nicotiana tabacum] CAA71815.1 ribonucleotide reductase [Nicotiana tabacum] Length = 808 Score = 87.4 bits (215), Expect(3) = 9e-25 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLK+QGKVVERP HMLM V VGIHKD+IESV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKIQGKVVERPQHMLMRVSVGIHKDDIESVIKT 189 Score = 47.0 bits (110), Expect(3) = 9e-25 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I ++ K ++L+SQRWFTHASPTLFNAGT Sbjct: 183 IESVIKTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 9e-25 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >XP_019179550.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit-like isoform X3 [Ipomoea nil] Length = 694 Score = 87.4 bits (215), Expect(3) = 1e-24 Identities = 43/53 (81%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKDNIES T Sbjct: 23 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDNIESAIKT 75 Score = 44.7 bits (104), Expect(3) = 1e-24 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I + K ++L+SQRWFTHASPTLFN GT Sbjct: 69 IESAIKTYHLMSQRWFTHASPTLFNGGT 96 Score = 28.5 bits (62), Expect(3) = 1e-24 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +2 Query: 173 LLVLQNADFLDSEFIYDKD 229 L V QNA LDSE IYD+D Sbjct: 8 LFVSQNASRLDSEIIYDRD 26 >XP_019179548.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit-like isoform X1 [Ipomoea nil] Length = 834 Score = 87.4 bits (215), Expect(3) = 3e-24 Identities = 43/53 (81%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKDNIES T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDNIESAIKT 189 Score = 44.7 bits (104), Expect(3) = 3e-24 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I + K ++L+SQRWFTHASPTLFN GT Sbjct: 183 IESAIKTYHLMSQRWFTHASPTLFNGGT 210 Score = 27.3 bits (59), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNASRLDSEIIYDRD 140 >XP_004288327.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Fragaria vesca subsp. vesca] Length = 810 Score = 87.0 bits (214), Expect(3) = 3e-24 Identities = 43/53 (81%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+IESV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDDIESVIKT 189 Score = 45.8 bits (107), Expect(3) = 3e-24 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I ++ K ++L+SQRWFTHASPTLFN+GT Sbjct: 183 IESVIKTYHLMSQRWFTHASPTLFNSGT 210 Score = 26.6 bits (57), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAVCLDSEIIYDRD 140 >XP_019179549.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit-like isoform X2 [Ipomoea nil] Length = 808 Score = 87.4 bits (215), Expect(3) = 3e-24 Identities = 43/53 (81%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKDNIES T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDNIESAIKT 189 Score = 44.7 bits (104), Expect(3) = 3e-24 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I + K ++L+SQRWFTHASPTLFN GT Sbjct: 183 IESAIKTYHLMSQRWFTHASPTLFNGGT 210 Score = 27.3 bits (59), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNASRLDSEIIYDRD 140 >XP_015583930.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Ricinus communis] Length = 812 Score = 85.9 bits (211), Expect(3) = 3e-24 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+I+SV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDDIDSVIKT 189 Score = 46.6 bits (109), Expect(3) = 3e-24 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 358 NLFKIHNLISQRWFTHASPTLFNAGT 435 ++ K ++L+SQRWFTHASPTLFNAGT Sbjct: 185 SVIKTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >OAY35986.1 hypothetical protein MANES_12G146100 [Manihot esculenta] Length = 811 Score = 85.9 bits (211), Expect(3) = 3e-24 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+I+SV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDDIDSVIKT 189 Score = 46.6 bits (109), Expect(3) = 3e-24 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 358 NLFKIHNLISQRWFTHASPTLFNAGT 435 ++ K ++L+SQRWFTHASPTLFNAGT Sbjct: 185 SVIKTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >XP_009372719.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Pyrus x bretschneideri] Length = 809 Score = 86.7 bits (213), Expect(3) = 3e-24 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+I+SV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVSVGIHKDDIDSVIKT 189 Score = 45.4 bits (106), Expect(3) = 3e-24 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = +1 Query: 358 NLFKIHNLISQRWFTHASPTLFNAGT 435 ++ K ++L+SQRWFTHASPTLFN+GT Sbjct: 185 SVIKTYHLMSQRWFTHASPTLFNSGT 210 Score = 26.9 bits (58), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAACLDSEIIYDRD 140 >XP_008338765.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Malus domestica] Length = 809 Score = 86.7 bits (213), Expect(3) = 3e-24 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+I+SV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVSVGIHKDDIDSVIKT 189 Score = 45.4 bits (106), Expect(3) = 3e-24 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = +1 Query: 358 NLFKIHNLISQRWFTHASPTLFNAGT 435 ++ K ++L+SQRWFTHASPTLFN+GT Sbjct: 185 SVIKTYHLMSQRWFTHASPTLFNSGT 210 Score = 26.9 bits (58), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAACLDSEIIYDRD 140 >GAV84480.1 Ribonuc_red_lgN domain-containing protein/Ribonuc_red_lgC domain-containing protein/ATP-cone domain-containing protein [Cephalotus follicularis] Length = 808 Score = 86.7 bits (213), Expect(3) = 3e-24 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+I+SV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVSVGIHKDDIDSVIKT 189 Score = 45.8 bits (107), Expect(3) = 3e-24 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = +1 Query: 358 NLFKIHNLISQRWFTHASPTLFNAGT 435 ++ K ++++SQRWFTHASPTLFNAGT Sbjct: 185 SVIKTYHMMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >EEF28063.1 ribonucleoside-diphosphate reductase large chain, putative [Ricinus communis] Length = 776 Score = 85.9 bits (211), Expect(3) = 3e-24 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+I+SV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDDIDSVIKT 189 Score = 46.6 bits (109), Expect(3) = 3e-24 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 358 NLFKIHNLISQRWFTHASPTLFNAGT 435 ++ K ++L+SQRWFTHASPTLFNAGT Sbjct: 185 SVIKTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 3e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >XP_019260593.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Nicotiana attenuata] OIT39065.1 ribonucleoside-diphosphate reductase large subunit [Nicotiana attenuata] Length = 808 Score = 85.9 bits (211), Expect(3) = 4e-24 Identities = 41/53 (77%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLK+QGKVVERP HMLM V VGIHKD+IES T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKIQGKVVERPQHMLMRVSVGIHKDDIESAIKT 189 Score = 46.2 bits (108), Expect(3) = 4e-24 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I + K ++L+SQRWFTHASPTLFNAGT Sbjct: 183 IESAIKTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 4e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >XP_010261001.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Nelumbo nucifera] Length = 808 Score = 85.9 bits (211), Expect(3) = 4e-24 Identities = 42/53 (79%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+IES T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVTVGIHKDDIESAIKT 189 Score = 46.2 bits (108), Expect(3) = 4e-24 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I + K ++L+SQRWFTHASPTLFNAGT Sbjct: 183 IESAIKTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 4e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >XP_015071402.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Solanum pennellii] Length = 808 Score = 85.1 bits (209), Expect(3) = 4e-24 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLK+ GK+VERP HMLM V VGIHKD+IESV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKIHGKIVERPQHMLMRVSVGIHKDDIESVIKT 189 Score = 47.0 bits (110), Expect(3) = 4e-24 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I ++ K ++L+SQRWFTHASPTLFNAGT Sbjct: 183 IESVIKTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 4e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAARLDSEIIYDRD 140 >XP_012571595.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit [Cicer arietinum] Length = 663 Score = 86.7 bits (213), Expect(3) = 4e-24 Identities = 42/53 (79%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+IES T Sbjct: 129 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVSVGIHKDDIESAVKT 181 Score = 45.8 bits (107), Expect(3) = 4e-24 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 367 KIHNLISQRWFTHASPTLFNAGT 435 K ++L+SQRWFTHASPTLFNAGT Sbjct: 180 KTYHLMSQRWFTHASPTLFNAGT 202 Score = 26.2 bits (56), Expect(3) = 4e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 115 VIMKNAAQLDSEIIYDRD 132 >XP_011090447.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit isoform X1 [Sesamum indicum] Length = 844 Score = 85.9 bits (211), Expect(3) = 5e-24 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+I+SV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDDIDSVIKT 189 Score = 47.0 bits (110), Expect(3) = 5e-24 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 358 NLFKIHNLISQRWFTHASPTLFNAGT 435 ++ K ++L+SQRWFTHASPTLFNAGT Sbjct: 185 SVIKTYHLLSQRWFTHASPTLFNAGT 210 Score = 25.4 bits (54), Expect(3) = 5e-24 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++N+ LDSE IYD+D Sbjct: 123 IIMKNSARLDSEIIYDRD 140 >XP_011090448.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit isoform X2 [Sesamum indicum] Length = 809 Score = 85.9 bits (211), Expect(3) = 5e-24 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKVQGKVVERP HMLM V VGIHKD+I+SV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVQGKVVERPQHMLMRVAVGIHKDDIDSVIKT 189 Score = 47.0 bits (110), Expect(3) = 5e-24 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 358 NLFKIHNLISQRWFTHASPTLFNAGT 435 ++ K ++L+SQRWFTHASPTLFNAGT Sbjct: 185 SVIKTYHLLSQRWFTHASPTLFNAGT 210 Score = 25.4 bits (54), Expect(3) = 5e-24 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++N+ LDSE IYD+D Sbjct: 123 IIMKNSARLDSEIIYDRD 140 >XP_012572237.1 PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Cicer arietinum] Length = 810 Score = 85.5 bits (210), Expect(3) = 7e-24 Identities = 41/53 (77%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKV+GKVVERP HMLM V VGIHKD+IES T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVEGKVVERPQHMLMRVSVGIHKDDIESAVKT 189 Score = 45.8 bits (107), Expect(3) = 7e-24 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 367 KIHNLISQRWFTHASPTLFNAGT 435 K ++L+SQRWFTHASPTLFNAGT Sbjct: 188 KTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.6 bits (57), Expect(3) = 7e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAAQLDSEIIYDRD 140 >XP_020089354.1 ribonucleoside-diphosphate reductase large subunit [Ananas comosus] Length = 809 Score = 85.1 bits (209), Expect(3) = 7e-24 Identities = 42/53 (79%), Positives = 43/53 (81%) Frame = +3 Query: 216 YMTKIDYDYFGFKTLERSYLLKVQGKVVERPPHMLMSVDVGIHKDNIESVQNT 374 Y DYDYFGFKTLERSYLLKV GKVVERP HMLM V VGIHKD+IESV T Sbjct: 137 YDRDFDYDYFGFKTLERSYLLKVSGKVVERPQHMLMRVAVGIHKDDIESVIRT 189 Score = 45.8 bits (107), Expect(3) = 7e-24 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 352 ILNLFKIHNLISQRWFTHASPTLFNAGT 435 I ++ + ++L+SQRWFTHASPTLFNAGT Sbjct: 183 IESVIRTYHLMSQRWFTHASPTLFNAGT 210 Score = 26.9 bits (58), Expect(3) = 7e-24 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 176 LVLQNADFLDSEFIYDKD 229 ++++NA LDSE IYD+D Sbjct: 123 IIMKNAACLDSEIIYDRD 140