BLASTX nr result
ID: Papaver32_contig00038576
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00038576 (1987 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAP04349.1 hypothetical protein AXX17_AT3G38190 [Arabidopsis tha... 61 3e-08 OAP02617.1 hypothetical protein AXX17_AT3G38130 [Arabidopsis tha... 61 5e-08 OAP02616.1 hypothetical protein AXX17_AT3G38130 [Arabidopsis tha... 61 8e-08 XP_006419117.1 hypothetical protein EUTSA_v10002731mg [Eutrema s... 61 8e-08 KFK33892.1 hypothetical protein AALP_AA5G074300 [Arabis alpina] 61 3e-07 XP_006279381.1 hypothetical protein CARUB_v10008000mg [Capsella ... 61 3e-07 CAB72464.1 protein-tyrosine-phosphatase-like protein [Arabidopsi... 61 3e-07 OAP01474.1 hypothetical protein AXX17_AT3G38280 [Arabidopsis tha... 59 4e-07 XP_009420522.2 PREDICTED: uncharacterized protein LOC104000247 [... 62 7e-07 XP_002875678.1 hypothetical protein ARALYDRAFT_905578 [Arabidops... 61 7e-07 XP_010503112.1 PREDICTED: uncharacterized protein LOC104780309 i... 61 8e-07 CDX99187.1 BnaA06g18780D [Brassica napus] 61 8e-07 XP_009150312.1 PREDICTED: uncharacterized protein LOC103873660 [... 61 8e-07 XP_013623214.1 PREDICTED: putative low molecular weight protein-... 61 8e-07 CDY08716.1 BnaC03g54660D [Brassica napus] 61 8e-07 XP_002875675.1 protein tyrosine phosphatase [Arabidopsis lyrata ... 61 8e-07 NP_190048.2 protein-tyrosine phosphatase [Arabidopsis thaliana] ... 61 8e-07 XP_010425879.1 PREDICTED: uncharacterized protein LOC104710926 [... 61 8e-07 XP_018433987.1 PREDICTED: uncharacterized protein LOC108806385 [... 61 9e-07 XP_006279380.1 hypothetical protein CARUB_v10007998mg, partial [... 61 9e-07 >OAP04349.1 hypothetical protein AXX17_AT3G38190 [Arabidopsis thaliana] Length = 78 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 26 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 59 >OAP02617.1 hypothetical protein AXX17_AT3G38130 [Arabidopsis thaliana] Length = 101 Score = 61.2 bits (147), Expect = 5e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 63 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 96 >OAP02616.1 hypothetical protein AXX17_AT3G38130 [Arabidopsis thaliana] Length = 115 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 63 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 96 >XP_006419117.1 hypothetical protein EUTSA_v10002731mg [Eutrema salsugineum] ESQ37553.1 hypothetical protein EUTSA_v10002731mg [Eutrema salsugineum] Length = 115 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 63 ADKKVKLMCSYCKKHNDKVVPDPYYGGAQGFEKV 96 >KFK33892.1 hypothetical protein AALP_AA5G074300 [Arabis alpina] Length = 175 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 123 ADKKVKLMCSYCKKHNDKYVPDPYYGGAQGFEKV 156 >XP_006279381.1 hypothetical protein CARUB_v10008000mg [Capsella rubella] EOA12279.1 hypothetical protein CARUB_v10008000mg [Capsella rubella] Length = 175 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 125 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 158 >CAB72464.1 protein-tyrosine-phosphatase-like protein [Arabidopsis thaliana] AAQ65131.1 At3g44620 [Arabidopsis thaliana] Length = 177 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 125 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 158 >OAP01474.1 hypothetical protein AXX17_AT3G38280 [Arabidopsis thaliana] Length = 103 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 144 EVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 +VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 54 KVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 84 >XP_009420522.2 PREDICTED: uncharacterized protein LOC104000247 [Musa acuminata subsp. malaccensis] Length = 273 Score = 62.0 bits (149), Expect = 7e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 AS++VKLMC +CKKHNE V DPYYGGLQGFEKV Sbjct: 215 ASKKVKLMCSFCKKHNEAEVPDPYYGGLQGFEKV 248 >XP_002875678.1 hypothetical protein ARALYDRAFT_905578 [Arabidopsis lyrata subsp. lyrata] EFH51937.1 hypothetical protein ARALYDRAFT_905578 [Arabidopsis lyrata subsp. lyrata] Length = 227 Score = 61.2 bits (147), Expect = 7e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 175 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 208 >XP_010503112.1 PREDICTED: uncharacterized protein LOC104780309 isoform X2 [Camelina sativa] Length = 231 Score = 61.2 bits (147), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 181 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 214 >CDX99187.1 BnaA06g18780D [Brassica napus] Length = 231 Score = 61.2 bits (147), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 179 ADKKVKLMCSYCKKHNDKVVPDPYYGGAQGFEKV 212 >XP_009150312.1 PREDICTED: uncharacterized protein LOC103873660 [Brassica rapa] XP_013642708.1 PREDICTED: putative low molecular weight protein-tyrosine-phosphatase slr0328 [Brassica napus] Length = 232 Score = 61.2 bits (147), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 180 ADKKVKLMCSYCKKHNDKVVPDPYYGGAQGFEKV 213 >XP_013623214.1 PREDICTED: putative low molecular weight protein-tyrosine-phosphatase slr0328 [Brassica oleracea var. oleracea] Length = 235 Score = 61.2 bits (147), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 183 ADKKVKLMCSYCKKHNDKVVPDPYYGGAQGFEKV 216 >CDY08716.1 BnaC03g54660D [Brassica napus] Length = 235 Score = 61.2 bits (147), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 183 ADKKVKLMCSYCKKHNDKVVPDPYYGGAQGFEKV 216 >XP_002875675.1 protein tyrosine phosphatase [Arabidopsis lyrata subsp. lyrata] EFH51934.1 protein tyrosine phosphatase [Arabidopsis lyrata subsp. lyrata] Length = 236 Score = 61.2 bits (147), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 184 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 217 >NP_190048.2 protein-tyrosine phosphatase [Arabidopsis thaliana] BAD42934.1 protein-tyrosine-phosphatase-like protein [Arabidopsis thaliana] BAD44284.1 protein-tyrosine-phosphatase-like protein [Arabidopsis thaliana] AEE77922.1 protein-tyrosine phosphatase [Arabidopsis thaliana] Length = 239 Score = 61.2 bits (147), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 187 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 220 >XP_010425879.1 PREDICTED: uncharacterized protein LOC104710926 [Camelina sativa] Length = 239 Score = 61.2 bits (147), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 187 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 220 >XP_018433987.1 PREDICTED: uncharacterized protein LOC108806385 [Raphanus sativus] Length = 240 Score = 61.2 bits (147), Expect = 9e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 188 ADKKVKLMCSYCKKHNDKVVPDPYYGGAQGFEKV 221 >XP_006279380.1 hypothetical protein CARUB_v10007998mg, partial [Capsella rubella] EOA12278.1 hypothetical protein CARUB_v10007998mg, partial [Capsella rubella] Length = 246 Score = 61.2 bits (147), Expect = 9e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 153 ASREVKLMCLYCKKHNEK*VSDPYYGGLQGFEKV 52 A ++VKLMC YCKKHN+K V DPYYGG QGFEKV Sbjct: 196 ADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKV 229