BLASTX nr result
ID: Papaver32_contig00038103
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00038103 (587 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010916704.1 PREDICTED: F-box protein At3g07870-like [Elaeis g... 56 7e-06 >XP_010916704.1 PREDICTED: F-box protein At3g07870-like [Elaeis guineensis] Length = 385 Score = 55.8 bits (133), Expect = 7e-06 Identities = 31/112 (27%), Positives = 55/112 (49%) Frame = -2 Query: 463 YAFGYDPATKEHKVVAFWHKTTDTWHGTRFDAVCEVLTICGREDKGCSNSSCRRFHEVSL 284 Y FG+D TK++KVV ++ T + RF EV T+ G + + R F+ Sbjct: 158 YGFGFDYLTKKYKVVRVFYPTNSRFRNPRFGVTAEVCTL------GATWKAVRGFNHPP- 210 Query: 283 PLKVVPHEFGKPLYSSGYIYWLYEDLLLKKEPFILQFNVGTEGFRLFSVPNF 128 + +P++++G ++WL LL +K I+ F++G + F + P F Sbjct: 211 --------YSRPVFANGAVHWLVHPLLSQKYKRIISFDIGKDEFNVTPHPKF 254