BLASTX nr result
ID: Papaver32_contig00037770
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00037770 (938 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP17596.1 unnamed protein product [Coffea canephora] 75 1e-13 ACU18542.1 unknown, partial [Glycine max] 75 2e-12 XP_011625634.1 PREDICTED: AP2-like ethylene-responsive transcrip... 74 4e-12 KZN00311.1 hypothetical protein DCAR_009065 [Daucus carota subsp... 77 5e-12 KDO48202.1 hypothetical protein CISIN_1g018292mg [Citrus sinensis] 76 5e-12 XP_006654350.1 PREDICTED: AP2-like ethylene-responsive transcrip... 75 8e-12 ABY55158.1 AP2/EREBP-like protein [Oryza sativa Indica Group] 75 8e-12 BAJ86967.1 predicted protein [Hordeum vulgare subsp. vulgare] 75 9e-12 KDO48203.1 hypothetical protein CISIN_1g018292mg [Citrus sinensis] 75 9e-12 XP_006411435.1 hypothetical protein EUTSA_v10016812mg [Eutrema s... 75 1e-11 XP_006411436.1 hypothetical protein EUTSA_v10016812mg [Eutrema s... 75 1e-11 XP_010247508.1 PREDICTED: AP2-like ethylene-responsive transcrip... 75 1e-11 XP_009386857.1 PREDICTED: AP2-like ethylene-responsive transcrip... 75 1e-11 XP_009386856.1 PREDICTED: AP2-like ethylene-responsive transcrip... 75 1e-11 XP_011096751.1 PREDICTED: AP2-like ethylene-responsive transcrip... 75 1e-11 EOY09154.1 AP2 domain-containing transcription factor isoform 1 ... 75 1e-11 KJB19262.1 hypothetical protein B456_003G091500 [Gossypium raimo... 75 1e-11 XP_010545448.1 PREDICTED: AP2-like ethylene-responsive transcrip... 75 1e-11 KRH66913.1 hypothetical protein GLYMA_03G136100 [Glycine max] 75 1e-11 JAT44435.1 AP2-like ethylene-responsive transcription factor At2... 75 1e-11 >CDP17596.1 unnamed protein product [Coffea canephora] Length = 92 Score = 75.5 bits (184), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 56 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 86 >ACU18542.1 unknown, partial [Glycine max] Length = 219 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 97 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 127 >XP_011625634.1 PREDICTED: AP2-like ethylene-responsive transcription factor At2g41710 [Amborella trichopoda] Length = 212 Score = 74.3 bits (181), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWN+NQNKKGKQVYL Sbjct: 88 RHRWTGRYEAHLWDKSTWNENQNKKGKQVYL 118 >KZN00311.1 hypothetical protein DCAR_009065 [Daucus carota subsp. sativus] Length = 409 Score = 76.6 bits (187), Expect = 5e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYLDFV 534 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL V Sbjct: 85 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYLGLV 118 >KDO48202.1 hypothetical protein CISIN_1g018292mg [Citrus sinensis] Length = 352 Score = 76.3 bits (186), Expect = 5e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYLD 540 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL+ Sbjct: 78 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYLE 109 >XP_006654350.1 PREDICTED: AP2-like ethylene-responsive transcription factor At2g41710 [Oryza brachyantha] Length = 346 Score = 75.5 bits (184), Expect = 8e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 18 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 48 >ABY55158.1 AP2/EREBP-like protein [Oryza sativa Indica Group] Length = 348 Score = 75.5 bits (184), Expect = 8e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 18 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 48 >BAJ86967.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 355 Score = 75.5 bits (184), Expect = 9e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 18 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 48 >KDO48203.1 hypothetical protein CISIN_1g018292mg [Citrus sinensis] Length = 358 Score = 75.5 bits (184), Expect = 9e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 78 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 108 >XP_006411435.1 hypothetical protein EUTSA_v10016812mg [Eutrema salsugineum] BAJ34620.1 unnamed protein product [Eutrema halophilum] ESQ52888.1 hypothetical protein EUTSA_v10016812mg [Eutrema salsugineum] Length = 369 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 78 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 108 >XP_006411436.1 hypothetical protein EUTSA_v10016812mg [Eutrema salsugineum] ESQ52889.1 hypothetical protein EUTSA_v10016812mg [Eutrema salsugineum] Length = 374 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 78 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 108 >XP_010247508.1 PREDICTED: AP2-like ethylene-responsive transcription factor At2g41710 isoform X2 [Nelumbo nucifera] Length = 384 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 30 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 60 >XP_009386857.1 PREDICTED: AP2-like ethylene-responsive transcription factor At2g41710 isoform X2 [Musa acuminata subsp. malaccensis] Length = 399 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 70 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 100 >XP_009386856.1 PREDICTED: AP2-like ethylene-responsive transcription factor At2g41710 isoform X1 [Musa acuminata subsp. malaccensis] Length = 400 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 70 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 100 >XP_011096751.1 PREDICTED: AP2-like ethylene-responsive transcription factor At2g41710 isoform X3 [Sesamum indicum] Length = 405 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 75 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 105 >EOY09154.1 AP2 domain-containing transcription factor isoform 1 [Theobroma cacao] Length = 406 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 71 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 101 >KJB19262.1 hypothetical protein B456_003G091500 [Gossypium raimondii] Length = 407 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 71 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 101 >XP_010545448.1 PREDICTED: AP2-like ethylene-responsive transcription factor At2g41710 isoform X2 [Tarenaya hassleriana] Length = 407 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 76 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 106 >KRH66913.1 hypothetical protein GLYMA_03G136100 [Glycine max] Length = 408 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 68 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 98 >JAT44435.1 AP2-like ethylene-responsive transcription factor At2g41710 [Anthurium amnicola] JAT65690.1 AP2-like ethylene-responsive transcription factor At2g41710 [Anthurium amnicola] Length = 410 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 635 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 543 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL Sbjct: 109 RHRWTGRYEAHLWDKSTWNQNQNKKGKQVYL 139