BLASTX nr result
ID: Papaver32_contig00037669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00037669 (527 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT63656.1 Ankyrin repeat domain-containing protein 2 [Anthurium... 57 2e-06 KJB47135.1 hypothetical protein B456_008G012100 [Gossypium raimo... 55 8e-06 KJB47136.1 hypothetical protein B456_008G012100 [Gossypium raimo... 55 8e-06 KJB47137.1 hypothetical protein B456_008G012100 [Gossypium raimo... 55 8e-06 XP_010070187.1 PREDICTED: ankyrin repeat domain-containing prote... 55 8e-06 KCW58824.1 hypothetical protein EUGRSUZ_H01461 [Eucalyptus grandis] 55 9e-06 KJB47138.1 hypothetical protein B456_008G012100 [Gossypium raimo... 55 9e-06 XP_012435974.1 PREDICTED: ankyrin repeat domain-containing prote... 55 9e-06 >JAT63656.1 Ankyrin repeat domain-containing protein 2 [Anthurium amnicola] Length = 342 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 119 SQEDLEELMTSVKKDPYLKTILEDIETGGPTVLMRYLND 3 S+E LEE M+ +K+DP LK IL+DIETGGPT +M+Y ND Sbjct: 141 SREQLEERMSRIKEDPSLKPILDDIETGGPTAMMKYWND 179 >KJB47135.1 hypothetical protein B456_008G012100 [Gossypium raimondii] Length = 329 Score = 55.1 bits (131), Expect = 8e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 116 QEDLEELMTSVKKDPYLKTILEDIETGGPTVLMRYLND 3 ++ +EE MT +K+DP LK ILE+IETGGPT +MRY ND Sbjct: 162 KDQIEERMTRIKEDPSLKHILEEIETGGPTAMMRYWND 199 >KJB47136.1 hypothetical protein B456_008G012100 [Gossypium raimondii] Length = 339 Score = 55.1 bits (131), Expect = 8e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 116 QEDLEELMTSVKKDPYLKTILEDIETGGPTVLMRYLND 3 ++ +EE MT +K+DP LK ILE+IETGGPT +MRY ND Sbjct: 162 KDQIEERMTRIKEDPSLKHILEEIETGGPTAMMRYWND 199 >KJB47137.1 hypothetical protein B456_008G012100 [Gossypium raimondii] Length = 341 Score = 55.1 bits (131), Expect = 8e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 116 QEDLEELMTSVKKDPYLKTILEDIETGGPTVLMRYLND 3 ++ +EE MT +K+DP LK ILE+IETGGPT +MRY ND Sbjct: 142 KDQIEERMTRIKEDPSLKHILEEIETGGPTAMMRYWND 179 >XP_010070187.1 PREDICTED: ankyrin repeat domain-containing protein 2A [Eucalyptus grandis] Length = 342 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -1 Query: 131 ATSISQEDLEELMTSVKKDPYLKTILEDIETGGPTVLMRYLND 3 A + +E +EE M +K+DP LK ILE+IETGGPT +MRY ND Sbjct: 140 ANPLRKEQMEERMALMKEDPSLKPILEEIETGGPTAMMRYWND 182 >KCW58824.1 hypothetical protein EUGRSUZ_H01461 [Eucalyptus grandis] Length = 348 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -1 Query: 131 ATSISQEDLEELMTSVKKDPYLKTILEDIETGGPTVLMRYLND 3 A + +E +EE M +K+DP LK ILE+IETGGPT +MRY ND Sbjct: 146 ANPLRKEQMEERMALMKEDPSLKPILEEIETGGPTAMMRYWND 188 >KJB47138.1 hypothetical protein B456_008G012100 [Gossypium raimondii] Length = 356 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 116 QEDLEELMTSVKKDPYLKTILEDIETGGPTVLMRYLND 3 ++ +EE MT +K+DP LK ILE+IETGGPT +MRY ND Sbjct: 162 KDQIEERMTRIKEDPSLKHILEEIETGGPTAMMRYWND 199 >XP_012435974.1 PREDICTED: ankyrin repeat domain-containing protein 2 [Gossypium raimondii] XP_012435976.1 PREDICTED: ankyrin repeat domain-containing protein 2 [Gossypium raimondii] KJB47134.1 hypothetical protein B456_008G012100 [Gossypium raimondii] Length = 361 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 116 QEDLEELMTSVKKDPYLKTILEDIETGGPTVLMRYLND 3 ++ +EE MT +K+DP LK ILE+IETGGPT +MRY ND Sbjct: 162 KDQIEERMTRIKEDPSLKHILEEIETGGPTAMMRYWND 199