BLASTX nr result
ID: Papaver32_contig00037397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00037397 (482 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO80263.1 hypothetical protein CCACVL1_13048 [Corchorus capsula... 74 6e-13 OMO80260.1 hypothetical protein CCACVL1_13045 [Corchorus capsula... 69 8e-12 OMO80261.1 hypothetical protein CCACVL1_13046 [Corchorus capsula... 70 1e-11 OMP04658.1 hypothetical protein COLO4_09418 [Corchorus olitorius] 71 2e-11 CDY01270.1 BnaC05g24620D [Brassica napus] 70 3e-11 OMO80265.1 hypothetical protein CCACVL1_13050 [Corchorus capsula... 70 4e-11 XP_010687797.1 PREDICTED: F-box/FBD/LRR-repeat protein At5g56420... 70 4e-11 KJB45696.1 hypothetical protein B456_007G321500 [Gossypium raimo... 70 5e-11 XP_016747877.1 PREDICTED: F-box/FBD/LRR-repeat protein At5g56420... 70 5e-11 XP_012434473.1 PREDICTED: F-box/FBD/LRR-repeat protein At5g56420... 70 5e-11 XP_002880735.1 F-box family protein [Arabidopsis lyrata subsp. l... 69 7e-11 XP_011467836.1 PREDICTED: putative F-box/FBD/LRR-repeat protein ... 69 8e-11 XP_008777997.2 PREDICTED: F-box/LRR-repeat protein 25-like [Phoe... 69 1e-10 XP_019085295.1 PREDICTED: F-box/FBD/LRR-repeat protein At2g26030... 69 1e-10 XP_019085294.1 PREDICTED: F-box/FBD/LRR-repeat protein At2g26030... 69 1e-10 KMT20507.1 hypothetical protein BVRB_1g004910 [Beta vulgaris sub... 69 1e-10 XP_006294221.1 hypothetical protein CARUB_v10023218mg [Capsella ... 69 1e-10 XP_003529565.2 PREDICTED: FBD-associated F-box protein At1g66320... 68 2e-10 XP_010094608.1 Putative FBD-associated F-box protein [Morus nota... 68 2e-10 XP_013448651.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 68 2e-10 >OMO80263.1 hypothetical protein CCACVL1_13048 [Corchorus capsularis] Length = 286 Score = 74.3 bits (181), Expect = 6e-13 Identities = 37/60 (61%), Positives = 45/60 (75%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPEYFGLECTK 180 DRIS LP+PLIH ILSFLPTK VV+TSVLSKRW +WTSVP +D E ++ + CT+ Sbjct: 20 DRISNLPDPLIHQILSFLPTKMVVATSVLSKRWVSLWTSVPALD---QEDSDHICISCTE 76 >OMO80260.1 hypothetical protein CCACVL1_13045 [Corchorus capsularis] Length = 155 Score = 68.9 bits (167), Expect = 8e-12 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVID 132 DRIS LP+ LIH ILSFLPTK VV+TS+LSKRW +WTSVP +D Sbjct: 22 DRISNLPDALIHRILSFLPTKIVVATSLLSKRWVSLWTSVPTLD 65 >OMO80261.1 hypothetical protein CCACVL1_13046 [Corchorus capsularis] Length = 219 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVID 132 DRIS LP+ L+H ILSFLPTK VV+TSVLSKRW +WTSVP +D Sbjct: 26 DRISNLPDALLHQILSFLPTKTVVATSVLSKRWVSVWTSVPALD 69 >OMP04658.1 hypothetical protein COLO4_09418 [Corchorus olitorius] Length = 455 Score = 71.2 bits (173), Expect = 2e-11 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = +1 Query: 4 RISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVID 132 RI+ELP+P++H +LSFLPTK V+TS+LSKRWRY+WT VP +D Sbjct: 25 RINELPDPILHHLLSFLPTKLSVATSILSKRWRYLWTEVPALD 67 >CDY01270.1 BnaC05g24620D [Brassica napus] Length = 289 Score = 69.7 bits (169), Expect = 3e-11 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVID 132 DRISELPEPLI ILS LPTK V+STSVLSKRWR +W VP+++ Sbjct: 23 DRISELPEPLILQILSLLPTKLVISTSVLSKRWRSVWKKVPILE 66 >OMO80265.1 hypothetical protein CCACVL1_13050 [Corchorus capsularis] Length = 437 Score = 70.1 bits (170), Expect = 4e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVID 132 DRIS+LP+ LIH ILSFLPTK VV+TS+LSKRW +WTSVP +D Sbjct: 15 DRISDLPDALIHRILSFLPTKMVVATSLLSKRWVSVWTSVPALD 58 >XP_010687797.1 PREDICTED: F-box/FBD/LRR-repeat protein At5g56420 [Beta vulgaris subsp. vulgaris] KMT03460.1 hypothetical protein BVRB_8g191440 [Beta vulgaris subsp. vulgaris] Length = 450 Score = 70.1 bits (170), Expect = 4e-11 Identities = 28/48 (58%), Positives = 42/48 (87%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEV 144 +RI+ELP+ L+ IL+FLPT+C V+TS+LSKRW Y+WT+VPV+D +++ Sbjct: 17 NRINELPDKLLCHILAFLPTRCAVATSILSKRWMYVWTNVPVLDFMDL 64 >KJB45696.1 hypothetical protein B456_007G321500 [Gossypium raimondii] Length = 424 Score = 69.7 bits (169), Expect = 5e-11 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEF 150 DRIS+LP+ LIH ILSFL TK ++TS+LSKRW ++WTSVP++DL + F Sbjct: 20 DRISQLPDVLIHHILSFLSTKEAMATSILSKRWLWVWTSVPILDLQDTPF 69 >XP_016747877.1 PREDICTED: F-box/FBD/LRR-repeat protein At5g56420-like [Gossypium hirsutum] Length = 442 Score = 69.7 bits (169), Expect = 5e-11 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEF 150 DRIS+LP+ LIH ILSFL TK ++TS+LSKRW ++WTSVP++DL + F Sbjct: 20 DRISQLPDVLIHHILSFLSTKEAMATSILSKRWLWVWTSVPILDLQDAPF 69 >XP_012434473.1 PREDICTED: F-box/FBD/LRR-repeat protein At5g56420-like [Gossypium raimondii] Length = 442 Score = 69.7 bits (169), Expect = 5e-11 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEF 150 DRIS+LP+ LIH ILSFL TK ++TS+LSKRW ++WTSVP++DL + F Sbjct: 20 DRISQLPDVLIHHILSFLSTKEAMATSILSKRWLWVWTSVPILDLQDTPF 69 >XP_002880735.1 F-box family protein [Arabidopsis lyrata subsp. lyrata] EFH56994.1 F-box family protein, partial [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 69.3 bits (168), Expect = 7e-11 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPE 156 DRISELP+ L+ ILS+LPTK V TSVLSKRW ++W VPV+DL FPE Sbjct: 4 DRISELPDSLLTQILSYLPTKDSVKTSVLSKRWEFLWLRVPVLDLKVSNFPE 55 >XP_011467836.1 PREDICTED: putative F-box/FBD/LRR-repeat protein At4g03220 [Fragaria vesca subsp. vesca] Length = 527 Score = 69.3 bits (168), Expect = 8e-11 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEV 144 DRIS+LP+ ++HLILSFLP K V TSVL++RW +IW+S P+ID E+ Sbjct: 44 DRISDLPDDILHLILSFLPLKSVAQTSVLARRWSHIWSSYPIIDFYEI 91 >XP_008777997.2 PREDICTED: F-box/LRR-repeat protein 25-like [Phoenix dactylifera] Length = 428 Score = 68.9 bits (167), Expect = 1e-10 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPEYFGLE 171 +RISELP+P++H ILS+LPTK VV TS+LSKRWRY+W S + + +FP E Sbjct: 38 NRISELPDPILHHILSYLPTKLVVKTSILSKRWRYLWASCSHVHIGIDDFPSITSFE 94 >XP_019085295.1 PREDICTED: F-box/FBD/LRR-repeat protein At2g26030-like isoform X2 [Camelina sativa] Length = 441 Score = 68.9 bits (167), Expect = 1e-10 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPE 156 DRISELP+ L+ +LS+LPTK V TSVLSKRW +W SVPV+DL +FP+ Sbjct: 4 DRISELPDSLLTQVLSYLPTKDSVKTSVLSKRWELLWLSVPVLDLKVSDFPD 55 >XP_019085294.1 PREDICTED: F-box/FBD/LRR-repeat protein At2g26030-like isoform X1 [Camelina sativa] Length = 446 Score = 68.9 bits (167), Expect = 1e-10 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPE 156 DRISELP+ L+ +LS+LPTK V TSVLSKRW +W SVPV+DL +FP+ Sbjct: 4 DRISELPDSLLTQVLSYLPTKDSVKTSVLSKRWELLWLSVPVLDLKVSDFPD 55 >KMT20507.1 hypothetical protein BVRB_1g004910 [Beta vulgaris subsp. vulgaris] Length = 391 Score = 68.6 bits (166), Expect = 1e-10 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPEYF 162 D IS LP+ ++ L+LSFL TK VV TS+LSKRWRYIW VP +D + + P+Y+ Sbjct: 14 DCISILPDTVLCLVLSFLSTKSVVKTSILSKRWRYIWMKVPALDFTDTDKPDYY 67 >XP_006294221.1 hypothetical protein CARUB_v10023218mg [Capsella rubella] EOA27119.1 hypothetical protein CARUB_v10023218mg [Capsella rubella] Length = 445 Score = 68.6 bits (166), Expect = 1e-10 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPE 156 DRISELP+ L+ +LS+LPTK V TSVLSKRW +W +VPV+DL +FPE Sbjct: 4 DRISELPDSLLTQVLSYLPTKDSVKTSVLSKRWECLWLNVPVLDLKVSDFPE 55 >XP_003529565.2 PREDICTED: FBD-associated F-box protein At1g66320-like [Glycine max] KHN39352.1 FBD-associated F-box protein [Glycine soja] KRH47026.1 hypothetical protein GLYMA_07G004400 [Glycine max] Length = 391 Score = 68.2 bits (165), Expect = 2e-10 Identities = 28/58 (48%), Positives = 41/58 (70%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPEYFGLEC 174 DR+S LP+ ++H ILS L K V T VLSKRWR++WTS+PV++ L+ F ++ +C Sbjct: 28 DRVSNLPDEVLHRILSTLDAKSAVQTCVLSKRWRHVWTSLPVLNFLDSSFDDFLHFQC 85 >XP_010094608.1 Putative FBD-associated F-box protein [Morus notabilis] EXB56427.1 Putative FBD-associated F-box protein [Morus notabilis] Length = 458 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEF 150 DRISELP+P+IH ILS +PTK TSVLSKRWRY WTS+ + L + F Sbjct: 17 DRISELPDPIIHQILSLVPTKEAARTSVLSKRWRYTWTSISTVKLFDFCF 66 >XP_013448651.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH22678.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 389 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +1 Query: 1 DRISELPEPLIHLILSFLPTKCVVSTSVLSKRWRYIWTSVPVIDLLEVEFPEY 159 DRIS LP+P+IH ILSFLPTK +TS+LSKRW+ +W SVP + + FP Y Sbjct: 12 DRISALPDPIIHDILSFLPTKKSAATSILSKRWKPLWLSVPNLQFDDRSFPNY 64