BLASTX nr result
ID: Papaver32_contig00037325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00037325 (537 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012830531.1 PREDICTED: uncharacterized protein LOC105951627 [... 57 2e-06 >XP_012830531.1 PREDICTED: uncharacterized protein LOC105951627 [Erythranthe guttata] Length = 281 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 3/81 (3%) Frame = +2 Query: 260 RMFLLWCIGSFLFVDCSGKVDKRWC*-VLDN--LEEVGSFDWGTPALGNLYKRLDIWSSS 430 +++L++ +GS LF D + K WC VL++ L++VG++ WG+ L NLYK L I S + Sbjct: 6 QIYLVFLLGSILFPDKTCDRVKPWCMHVLEDSVLDQVGTYSWGSACLANLYKELGICSRA 65 Query: 431 NKGDMTGM*KILEFCYYFYLP 493 + G +L+ C Y Y P Sbjct: 66 QSRSLVGCTTLLQCCIYEYFP 86