BLASTX nr result
ID: Papaver32_contig00037183
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00037183 (457 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006392115.1 hypothetical protein EUTSA_v10023395mg [Eutrema s... 59 2e-07 XP_006302106.1 hypothetical protein CARUB_v10020097mg [Capsella ... 59 2e-07 BAD95134.1 hypothetical protein, partial [Arabidopsis thaliana] 58 5e-07 NP_176278.2 trichome birefringence-like protein (DUF828) [Arabid... 58 5e-07 AAB71964.1 Hypothetical protein [Arabidopsis thaliana] 58 5e-07 KFK40758.1 hypothetical protein AALP_AA2G037100 [Arabis alpina] 57 9e-07 JAU24488.1 Protein trichome birefringence-like 2 [Noccaea caerul... 57 2e-06 JAU48486.1 Protein trichome birefringence-like 2 [Noccaea caerul... 57 2e-06 XP_008812175.1 PREDICTED: protein trichome birefringence-like 2 ... 57 2e-06 JAU96949.1 Protein trichome birefringence-like 2 [Noccaea caerul... 56 2e-06 XP_010553609.1 PREDICTED: protein trichome birefringence-like 2 ... 56 2e-06 KDO82333.1 hypothetical protein CISIN_1g007771mg [Citrus sinensis] 56 2e-06 XP_006483906.1 PREDICTED: protein trichome birefringence-like 2 ... 56 2e-06 XP_006438320.1 hypothetical protein CICLE_v10031033mg [Citrus cl... 56 2e-06 CDP13190.1 unnamed protein product [Coffea canephora] 56 2e-06 XP_010940155.1 PREDICTED: protein trichome birefringence-like 2 ... 56 3e-06 XP_010510908.1 PREDICTED: protein trichome birefringence-like 2 ... 55 6e-06 XP_010418022.1 PREDICTED: protein trichome birefringence-like 2 ... 55 6e-06 CDY40499.1 BnaC09g14570D [Brassica napus] 55 7e-06 XP_019176635.1 PREDICTED: protein trichome birefringence-like 2 ... 55 8e-06 >XP_006392115.1 hypothetical protein EUTSA_v10023395mg [Eutrema salsugineum] ESQ29401.1 hypothetical protein EUTSA_v10023395mg [Eutrema salsugineum] Length = 548 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YPPG+CPYI++ F+ + GRP+DA++K WKWQ Sbjct: 200 YDGNWVRADDETMPYYPPGSCPYIDRD-FNCHANGRPDDAYVK--WKWQ 245 >XP_006302106.1 hypothetical protein CARUB_v10020097mg [Capsella rubella] EOA35004.1 hypothetical protein CARUB_v10020097mg [Capsella rubella] Length = 548 Score = 59.3 bits (142), Expect = 2e-07 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WVK + P+YPPG+CPYI++ F+ + GRP+DA++K W+WQ Sbjct: 200 YDGRWVKADDETMPYYPPGSCPYIDRD-FNCHANGRPDDAYVK--WRWQ 245 >BAD95134.1 hypothetical protein, partial [Arabidopsis thaliana] Length = 499 Score = 58.2 bits (139), Expect = 5e-07 Identities = 22/49 (44%), Positives = 36/49 (73%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YPPG+CPYI++ F+ + GRP+DA++K W+WQ Sbjct: 193 YDGSWVRADDETMPYYPPGSCPYIDRD-FNCHANGRPDDAYVK--WRWQ 238 >NP_176278.2 trichome birefringence-like protein (DUF828) [Arabidopsis thaliana] Q8VYR3.1 RecName: Full=Protein trichome birefringence-like 2 AAL49770.1 unknown protein [Arabidopsis thaliana] AAM91701.1 unknown protein [Arabidopsis thaliana] AEE33733.1 trichome birefringence-like protein (DUF828) [Arabidopsis thaliana] OAP16014.1 TBL2 [Arabidopsis thaliana] Length = 541 Score = 58.2 bits (139), Expect = 5e-07 Identities = 22/49 (44%), Positives = 36/49 (73%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YPPG+CPYI++ F+ + GRP+DA++K W+WQ Sbjct: 193 YDGSWVRADDETMPYYPPGSCPYIDRD-FNCHANGRPDDAYVK--WRWQ 238 >AAB71964.1 Hypothetical protein [Arabidopsis thaliana] Length = 664 Score = 58.2 bits (139), Expect = 5e-07 Identities = 22/49 (44%), Positives = 36/49 (73%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YPPG+CPYI++ F+ + GRP+DA++K W+WQ Sbjct: 193 YDGSWVRADDETMPYYPPGSCPYIDRD-FNCHANGRPDDAYVK--WRWQ 238 >KFK40758.1 hypothetical protein AALP_AA2G037100 [Arabis alpina] Length = 535 Score = 57.4 bits (137), Expect = 9e-07 Identities = 23/49 (46%), Positives = 35/49 (71%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YP G+CPYI++ F+ + GRP+DAF+K WKWQ Sbjct: 187 YDGNWVRDDDETMPYYPSGSCPYIDRD-FNCHANGRPDDAFVK--WKWQ 232 >JAU24488.1 Protein trichome birefringence-like 2 [Noccaea caerulescens] Length = 544 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = +1 Query: 304 FEGEWVKPKNNRE---PFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ ++ + P+YPPG+CPYI++ F+ + GRP+DAF+K WKWQ Sbjct: 193 YDGNWVRADDDDDETMPYYPPGSCPYIDRD-FNCHANGRPDDAFVK--WKWQ 241 >JAU48486.1 Protein trichome birefringence-like 2 [Noccaea caerulescens] JAU57367.1 Protein trichome birefringence-like 2 [Noccaea caerulescens] Length = 549 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = +1 Query: 304 FEGEWVKPKNNRE---PFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ ++ + P+YPPG+CPYI++ F+ + GRP+DAF+K WKWQ Sbjct: 193 YDGNWVRADDDDDETMPYYPPGSCPYIDRD-FNCHANGRPDDAFVK--WKWQ 241 >XP_008812175.1 PREDICTED: protein trichome birefringence-like 2 [Phoenix dactylifera] Length = 612 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ-YH 456 F G WV+ ++ EP+YP G+CPYI+ F+ + GRP+D FLK W+WQ YH Sbjct: 266 FHGRWVRDEH--EPYYPAGSCPYIDDD-FNCHKNGRPDDGFLK--WRWQPYH 312 >JAU96949.1 Protein trichome birefringence-like 2 [Noccaea caerulescens] Length = 550 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/53 (45%), Positives = 38/53 (71%), Gaps = 4/53 (7%) Frame = +1 Query: 304 FEGEWVKPKNNRE----PFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ ++ + P+YPPG+CPYI++ F+ + GRP+DAF+K WKWQ Sbjct: 193 YDGNWVRADDDDDDETMPYYPPGSCPYIDRD-FNCHANGRPDDAFVK--WKWQ 242 >XP_010553609.1 PREDICTED: protein trichome birefringence-like 2 [Tarenaya hassleriana] Length = 556 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/49 (44%), Positives = 35/49 (71%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YPPG+CPYI++ F+ + GR +DAF+K W+WQ Sbjct: 208 YDGNWVRVDDETMPYYPPGSCPYIDRD-FNCFANGRTDDAFVK--WRWQ 253 >KDO82333.1 hypothetical protein CISIN_1g007771mg [Citrus sinensis] Length = 590 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 F+G WV+ ++ +P+YPPG+CPYI++ F + GRP+D F+K WKWQ Sbjct: 245 FDGRWVR--DDSKPYYPPGSCPYIDRD-FDCHLNGRPDDGFVK--WKWQ 288 >XP_006483906.1 PREDICTED: protein trichome birefringence-like 2 [Citrus sinensis] Length = 590 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 F+G WV+ ++ +P+YPPG+CPYI++ F + GRP+D F+K WKWQ Sbjct: 245 FDGRWVR--DDSKPYYPPGSCPYIDRD-FDCHLNGRPDDGFVK--WKWQ 288 >XP_006438320.1 hypothetical protein CICLE_v10031033mg [Citrus clementina] ESR51560.1 hypothetical protein CICLE_v10031033mg [Citrus clementina] Length = 590 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 F+G WV+ ++ +P+YPPG+CPYI++ F + GRP+D F+K WKWQ Sbjct: 245 FDGRWVR--DDSKPYYPPGSCPYIDRD-FDCHLNGRPDDGFVK--WKWQ 288 >CDP13190.1 unnamed protein product [Coffea canephora] Length = 624 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ N+ +P+YPPG+CPYI++ F Y RP+D FLK WKWQ Sbjct: 279 YDGRWVR--NDAKPYYPPGSCPYIDRD-FDCYLNKRPDDNFLK--WKWQ 322 >XP_010940155.1 PREDICTED: protein trichome birefringence-like 2 [Elaeis guineensis] Length = 619 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ-YH 456 F+G WV+ + +EP+YP G+CP+I++ F + GRP+D FLK W+WQ YH Sbjct: 273 FDGRWVR--DEQEPYYPAGSCPFIDRD-FDCHTNGRPDDGFLK--WRWQPYH 319 >XP_010510908.1 PREDICTED: protein trichome birefringence-like 2 [Camelina sativa] Length = 541 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/49 (42%), Positives = 35/49 (71%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YP G+CPYI++ F+ + GRP+DA++K W+WQ Sbjct: 193 YDGSWVRADDETMPYYPSGSCPYIDRD-FNCHANGRPDDAYVK--WRWQ 238 >XP_010418022.1 PREDICTED: protein trichome birefringence-like 2 [Camelina sativa] Length = 545 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/49 (42%), Positives = 35/49 (71%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YP G+CPYI++ F+ + GRP+DA++K W+WQ Sbjct: 197 YDGSWVRADDETMPYYPSGSCPYIDRD-FNCHANGRPDDAYVK--WRWQ 242 >CDY40499.1 BnaC09g14570D [Brassica napus] Length = 493 Score = 54.7 bits (130), Expect = 7e-06 Identities = 21/49 (42%), Positives = 34/49 (69%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQ 450 ++G WV+ + P+YPPG+CPYI++ F+ + RP+D ++K WKWQ Sbjct: 145 YDGNWVRADDETMPYYPPGSCPYIDRD-FNCHANKRPDDGYVK--WKWQ 190 >XP_019176635.1 PREDICTED: protein trichome birefringence-like 2 [Ipomoea nil] Length = 533 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/51 (43%), Positives = 39/51 (76%) Frame = +1 Query: 304 FEGEWVKPKNNREPFYPPGTCPYIEQSPFHSYNYGRPEDAFLKLQWKWQYH 456 F+GEWV+ ++ +P+YPPG+CP+I++ F + + RP+DA++K W+W+ H Sbjct: 186 FDGEWVR--DDTKPYYPPGSCPFIDRD-FDCHLHKRPDDAYVK--WRWRPH 231