BLASTX nr result
ID: Papaver32_contig00037051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00037051 (405 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009413722.1 PREDICTED: protein GDAP2 homolog [Musa acuminata ... 55 5e-06 >XP_009413722.1 PREDICTED: protein GDAP2 homolog [Musa acuminata subsp. malaccensis] XP_009413723.1 PREDICTED: protein GDAP2 homolog [Musa acuminata subsp. malaccensis] Length = 560 Score = 54.7 bits (130), Expect = 5e-06 Identities = 30/55 (54%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +1 Query: 145 DLPVNDNGLKIIR-SLFFLNA*LVPAFMSISRDPDDRHREQREKSVAHMKSGFNC 306 DLPV+D GL + R + F L + L PAFMS+ +DPD R +EQ+EK+ A +SGFNC Sbjct: 299 DLPVSDVGLTLRRKNSFSLESYLDPAFMSLIKDPDQRRKEQQEKA-AQTQSGFNC 352