BLASTX nr result
ID: Papaver32_contig00036321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00036321 (504 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011622299.1 PREDICTED: dual specificity protein phosphatase P... 49 8e-07 ERN03334.1 hypothetical protein AMTR_s00003p00241010 [Amborella ... 49 8e-07 >XP_011622299.1 PREDICTED: dual specificity protein phosphatase PHS1 [Amborella trichopoda] Length = 903 Score = 48.5 bits (114), Expect(2) = 8e-07 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -1 Query: 384 DLLRSLVLISKLHDINRYAKVDAELHSVLKQWNEMCK 274 D LRSL L +KL D N+YAK+DAEL L+QWNEM + Sbjct: 605 DPLRSLRLTTKLKDFNKYAKLDAELSKELEQWNEMLR 641 Score = 31.6 bits (70), Expect(2) = 8e-07 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -3 Query: 487 SDPSHHRSSSTPGLYEIPDSASPIPRENLH 398 S+PS SSS+ E PDSASP+ REN H Sbjct: 569 SEPSFKSSSSSSK--ESPDSASPVSRENWH 596 >ERN03334.1 hypothetical protein AMTR_s00003p00241010 [Amborella trichopoda] Length = 903 Score = 48.5 bits (114), Expect(2) = 8e-07 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -1 Query: 384 DLLRSLVLISKLHDINRYAKVDAELHSVLKQWNEMCK 274 D LRSL L +KL D N+YAK+DAEL L+QWNEM + Sbjct: 605 DPLRSLRLTTKLKDFNKYAKLDAELSKELEQWNEMLR 641 Score = 31.6 bits (70), Expect(2) = 8e-07 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -3 Query: 487 SDPSHHRSSSTPGLYEIPDSASPIPRENLH 398 S+PS SSS+ E PDSASP+ REN H Sbjct: 569 SEPSFKSSSSSSK--ESPDSASPVSRENWH 596