BLASTX nr result
ID: Papaver32_contig00036080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00036080 (812 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO75474.1 hypothetical protein COLO4_26091 [Corchorus olitorius] 66 9e-09 KFK23872.1 hypothetical protein AALP_AAs57561U000100 [Arabis alp... 54 3e-06 >OMO75474.1 hypothetical protein COLO4_26091 [Corchorus olitorius] Length = 355 Score = 65.9 bits (159), Expect = 9e-09 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -2 Query: 145 SGYRVIEVLAGGASAMVEWRLETGRTHQV*TSTHRKGYEVLVPTT 11 S Y+VIEVLAGG SA+V+WRLETGRTHQ+ TST ++ + +L+PTT Sbjct: 300 SRYKVIEVLAGGGSALVQWRLETGRTHQISTSTLKRKHALLMPTT 344 >KFK23872.1 hypothetical protein AALP_AAs57561U000100 [Arabis alpina] Length = 56 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -2 Query: 145 SGYRVIEVLAGGASAMVEWRLETGRTHQV 59 S Y+VIE LAGGASA+VEWRLETGRTHQ+ Sbjct: 18 SRYKVIETLAGGASALVEWRLETGRTHQL 46