BLASTX nr result
ID: Papaver32_contig00035921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00035921 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010277336.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 8e-11 XP_012436918.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 8e-11 XP_017637318.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 8e-11 XP_016735240.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 8e-11 XP_016713059.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 8e-11 KDO79503.1 hypothetical protein CISIN_1g015673mg [Citrus sinensis] 67 2e-10 XP_006425713.1 hypothetical protein CICLE_v10025762mg [Citrus cl... 67 2e-10 XP_007046988.2 PREDICTED: pentatricopeptide repeat-containing pr... 67 2e-10 EOX91145.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 67 2e-10 XP_008338664.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-10 CBI17546.3 unnamed protein product, partial [Vitis vinifera] 66 5e-10 GAV69504.1 PPR domain-containing protein/PPR_2 domain-containing... 66 5e-10 XP_002271426.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 5e-10 CAN68320.1 hypothetical protein VITISV_032192 [Vitis vinifera] 66 5e-10 XP_008453729.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 5e-10 XP_002866998.1 pentatricopeptide repeat-containing protein [Arab... 65 1e-09 NP_195386.1 Tetratricopeptide repeat (TPR)-like superfamily prot... 65 1e-09 CAA05629.1 membrane-associated salt-inducible protein like, part... 65 1e-09 ONH96785.1 hypothetical protein PRUPE_7G151800 [Prunus persica] 65 1e-09 XP_009356679.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 >XP_010277336.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nelumbo nucifera] Length = 396 Score = 68.6 bits (166), Expect = 8e-11 Identities = 43/84 (51%), Positives = 50/84 (59%), Gaps = 6/84 (7%) Frame = +2 Query: 191 ISSFRHVRLFXXXXXXXXXXXXXXXRVARSELQREFDPDKALSIYLSVSDH------STR 352 +SS RHVR F A++ L+ E DPDKAL+IY SVSD S Sbjct: 4 LSSIRHVRRFSTSSAISIS-------AAKARLRSEHDPDKALAIYSSVSDRYSSPVSSRY 56 Query: 353 TRDLTIKRLAKSRRFSDIESLIES 424 +DLT+KRLAKSRRFSDIE LIES Sbjct: 57 AQDLTVKRLAKSRRFSDIEKLIES 80 >XP_012436918.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Gossypium raimondii] KJB48422.1 hypothetical protein B456_008G068700 [Gossypium raimondii] Length = 408 Score = 68.6 bits (166), Expect = 8e-11 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E+DPDKAL IY SVS H S +DLT++RLAKSRRFSDIESLIES Sbjct: 34 AKSKLRTEYDPDKALEIYSSVSKHYSSPSSSRYAQDLTVRRLAKSRRFSDIESLIES 90 >XP_017637318.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Gossypium arboreum] Length = 409 Score = 68.6 bits (166), Expect = 8e-11 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E+DPDKAL IY SVS H S +DLT++RLAKSRRFSDIESLIES Sbjct: 35 AKSKLRTEYDPDKALEIYSSVSKHYSSPSSSRYAQDLTVRRLAKSRRFSDIESLIES 91 >XP_016735240.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Gossypium hirsutum] Length = 409 Score = 68.6 bits (166), Expect = 8e-11 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E+DPDKAL IY SVS H S +DLT++RLAKSRRFSDIESLIES Sbjct: 35 AKSKLRTEYDPDKALEIYSSVSKHYSSPSSSRYAQDLTVRRLAKSRRFSDIESLIES 91 >XP_016713059.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Gossypium hirsutum] Length = 413 Score = 68.6 bits (166), Expect = 8e-11 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E+DPDKAL IY SVS H S +DLT++RLAKSRRFSDIESLIES Sbjct: 39 AKSKLRTEYDPDKALEIYSSVSKHYSSPSSSRYAQDLTVRRLAKSRRFSDIESLIES 95 >KDO79503.1 hypothetical protein CISIN_1g015673mg [Citrus sinensis] Length = 403 Score = 67.4 bits (163), Expect = 2e-10 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ EFDPDKAL IY SVS H S +DLT++RLAKS+RFSDIE+LIES Sbjct: 31 AKSKLRSEFDPDKALDIYSSVSKHYASPVSSRYAQDLTVRRLAKSKRFSDIETLIES 87 >XP_006425713.1 hypothetical protein CICLE_v10025762mg [Citrus clementina] XP_006466769.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Citrus sinensis] ESR38953.1 hypothetical protein CICLE_v10025762mg [Citrus clementina] Length = 403 Score = 67.4 bits (163), Expect = 2e-10 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ EFDPDKAL IY SVS H S +DLT++RLAKS+RFSDIE+LIES Sbjct: 31 AKSKLRSEFDPDKALEIYSSVSKHYASPVSSRYAQDLTVRRLAKSKRFSDIETLIES 87 >XP_007046988.2 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Theobroma cacao] Length = 411 Score = 67.4 bits (163), Expect = 2e-10 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+++L+ E+DPDKAL IY SVS H S +DLT++RLAKSRRFSDIESLIES Sbjct: 34 AKNKLRTEYDPDKALEIYSSVSKHYSSPSSSRYAQDLTVRRLAKSRRFSDIESLIES 90 >EOX91145.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 411 Score = 67.4 bits (163), Expect = 2e-10 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+++L+ E+DPDKAL IY SVS H S +DLT++RLAKSRRFSDIESLIES Sbjct: 34 AKNKLRTEYDPDKALEIYSSVSKHYSSPSSSRYAQDLTVRRLAKSRRFSDIESLIES 90 >XP_008338664.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Malus domestica] Length = 405 Score = 67.0 bits (162), Expect = 3e-10 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E+DPDKAL IY SVS+H S T+DLT++RLAKS RF+DIES IES Sbjct: 27 AKSKLRTEYDPDKALQIYSSVSEHYSSPTSSRYTQDLTVRRLAKSHRFADIESFIES 83 >CBI17546.3 unnamed protein product, partial [Vitis vinifera] Length = 371 Score = 66.2 bits (160), Expect = 5e-10 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDHSTR------TRDLTIKRLAKSRRFSDIESLIES 424 A+S L+ EFDPD+AL IY SVS H T +DLT+KRLAKSRRF+DIE+LIES Sbjct: 40 AKSILRSEFDPDRALEIYSSVSKHYTSPLASRYAQDLTVKRLAKSRRFADIETLIES 96 >GAV69504.1 PPR domain-containing protein/PPR_2 domain-containing protein, partial [Cephalotus follicularis] Length = 396 Score = 66.2 bits (160), Expect = 5e-10 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E DPDKAL IY SVS H S +D+T+KRLAKSRRF+DIESLIES Sbjct: 36 AKSKLRTEHDPDKALQIYSSVSKHYSFPASSRYAQDITVKRLAKSRRFADIESLIES 92 >XP_002271426.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Vitis vinifera] Length = 414 Score = 66.2 bits (160), Expect = 5e-10 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDHSTR------TRDLTIKRLAKSRRFSDIESLIES 424 A+S L+ EFDPD+AL IY SVS H T +DLT+KRLAKSRRF+DIE+LIES Sbjct: 40 AKSILRSEFDPDRALEIYSSVSKHYTSPLASRYAQDLTVKRLAKSRRFADIETLIES 96 >CAN68320.1 hypothetical protein VITISV_032192 [Vitis vinifera] Length = 416 Score = 66.2 bits (160), Expect = 5e-10 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDHSTR------TRDLTIKRLAKSRRFSDIESLIES 424 A+S L+ EFDPD+AL IY SVS H T +DLT+KRLAKSRRF+DIE+LIES Sbjct: 42 AKSILRSEFDPDRALEIYSSVSKHYTSPLASRYAQDLTVKRLAKSRRFADIETLIES 98 >XP_008453729.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Cucumis melo] Length = 423 Score = 66.2 bits (160), Expect = 5e-10 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDHSTR------TRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E+DPDKAL IY SVS H T +++TI+RLAKSRRF DIESLIES Sbjct: 41 AKSKLRNEYDPDKALEIYSSVSSHYTSPVTSRYAQEITIRRLAKSRRFKDIESLIES 97 >XP_002866998.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] EFH43257.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 411 Score = 65.5 bits (158), Expect = 1e-09 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDHSTR------TRDLTIKRLAKSRRFSDIESLIES 424 A+S L++E DPDKAL IY +VSDHS ++LT++RLAK RRFSDIE+LIES Sbjct: 36 AKSTLRKEHDPDKALKIYANVSDHSASPVSSRYAQELTVRRLAKCRRFSDIETLIES 92 >NP_195386.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana] Q9M065.1 RecName: Full=Pentatricopeptide repeat-containing protein At4g36680, mitochondrial; Flags: Precursor CAB16807.1 salt-inducible like protein [Arabidopsis thaliana] CAB80334.1 salt-inducible like protein [Arabidopsis thaliana] AAL36061.1 C7A10_680/C7A10_680 [Arabidopsis thaliana] AAN46757.1 At4g36680/C7A10_680 [Arabidopsis thaliana] AEE86686.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana] OAO99432.1 hypothetical protein AXX17_AT4G41780 [Arabidopsis thaliana] Length = 412 Score = 65.5 bits (158), Expect = 1e-09 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDHSTR------TRDLTIKRLAKSRRFSDIESLIES 424 A+S L++E DPDKAL IY +VSDHS ++LT++RLAK RRFSDIE+LIES Sbjct: 36 AKSTLRKEHDPDKALKIYANVSDHSASPVSSRYAQELTVRRLAKCRRFSDIETLIES 92 >CAA05629.1 membrane-associated salt-inducible protein like, partial [Arabidopsis thaliana] Length = 428 Score = 65.5 bits (158), Expect = 1e-09 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDHSTR------TRDLTIKRLAKSRRFSDIESLIES 424 A+S L++E DPDKAL IY +VSDHS ++LT++RLAK RRFSDIE+LIES Sbjct: 52 AKSTLRKEHDPDKALKIYANVSDHSASPVSSRYAQELTVRRLAKCRRFSDIETLIES 108 >ONH96785.1 hypothetical protein PRUPE_7G151800 [Prunus persica] Length = 405 Score = 65.1 bits (157), Expect = 1e-09 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E+DPDKAL IY SVS+H S +DLT++RLAKS RF+DIE LIES Sbjct: 26 AKSKLRTEYDPDKALEIYSSVSEHYSTPTSSRYAQDLTVRRLAKSHRFADIEKLIES 82 >XP_009356679.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Pyrus x bretschneideri] Length = 405 Score = 65.1 bits (157), Expect = 1e-09 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = +2 Query: 272 ARSELQREFDPDKALSIYLSVSDH------STRTRDLTIKRLAKSRRFSDIESLIES 424 A+S+L+ E+DPDKAL IY SVS+H S +DLT++RLAKS RF+DIES IES Sbjct: 27 AKSKLRTEYDPDKALQIYSSVSEHYSSPTSSRYAQDLTVRRLAKSHRFADIESFIES 83