BLASTX nr result
ID: Papaver32_contig00035836
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00035836 (987 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010266404.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 3e-16 EEF42321.1 pentatricopeptide repeat-containing protein, putative... 87 3e-15 XP_015575189.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 3e-15 XP_009764491.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 1e-14 XP_015070913.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 1e-14 XP_006347554.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 1e-14 XP_007029499.2 PREDICTED: pentatricopeptide repeat-containing pr... 86 1e-14 EOY10001.1 Pentatricopeptide repeat (PPR) superfamily protein [T... 86 1e-14 XP_019253719.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 2e-14 OAY44607.1 hypothetical protein MANES_08G165200 [Manihot esculenta] 85 2e-14 XP_008376869.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 3e-14 XP_015878584.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 4e-14 XP_009361219.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 4e-14 XP_007206704.1 hypothetical protein PRUPE_ppa023974mg [Prunus pe... 84 6e-14 XP_009381612.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 6e-14 XP_010318267.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 6e-14 ONI02054.1 hypothetical protein PRUPE_6G174500 [Prunus persica] 84 6e-14 XP_008245022.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 6e-14 XP_016564170.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 6e-14 XP_016481674.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 1e-13 >XP_010266404.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X1 [Nelumbo nucifera] Length = 1488 Score = 90.5 bits (223), Expect = 3e-16 Identities = 44/81 (54%), Positives = 60/81 (74%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVPV KEI++QLG+V PKKF+RLALL +D+R+KAI+ADI+GR++KLEK+K K VRP Sbjct: 1397 GLVPVFKEIHDQLGQVTPKKFARLALLPDDKRDKAIRADIEGRKQKLEKMKKKGRLVRPG 1456 Query: 805 KKSSSLRKVIRGEVPSIGNIR 743 K + + R + N+R Sbjct: 1457 NKFKKRKFIRRAILSDHSNVR 1477 >EEF42321.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1429 Score = 87.4 bits (215), Expect = 3e-15 Identities = 43/68 (63%), Positives = 55/68 (80%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP KEINE+LG VRPKKF++LALLS+D+R+KAI ADI+GR+EKLEK+KSK R + Sbjct: 1340 GLVPAFKEINEKLGFVRPKKFAKLALLSDDKRQKAIHADIEGRKEKLEKLKSKVDLERKN 1399 Query: 805 KKSSSLRK 782 K + R+ Sbjct: 1400 KTNKLRRR 1407 >XP_015575189.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Ricinus communis] Length = 1477 Score = 87.4 bits (215), Expect = 3e-15 Identities = 43/68 (63%), Positives = 55/68 (80%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP KEINE+LG VRPKKF++LALLS+D+R+KAI ADI+GR+EKLEK+KSK R + Sbjct: 1388 GLVPAFKEINEKLGFVRPKKFAKLALLSDDKRQKAIHADIEGRKEKLEKLKSKVDLERKN 1447 Query: 805 KKSSSLRK 782 K + R+ Sbjct: 1448 KTNKLRRR 1455 >XP_009764491.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Nicotiana sylvestris] XP_016434441.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Nicotiana tabacum] Length = 1460 Score = 85.9 bits (211), Expect = 1e-14 Identities = 42/79 (53%), Positives = 59/79 (74%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP ++INE+LG V P+KF+RLALLS+++REK IQADI+GRREKL K+K+ +R + Sbjct: 1379 GLVPAFEDINERLGSVSPRKFARLALLSDEKREKVIQADIEGRREKLAKLKNTAVTMRKN 1438 Query: 805 KKSSSLRKVIRGEVPSIGN 749 KS ++K +R P+ N Sbjct: 1439 TKSFRMKKFVRVPGPAKSN 1457 >XP_015070913.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Solanum pennellii] Length = 1475 Score = 85.9 bits (211), Expect = 1e-14 Identities = 44/76 (57%), Positives = 55/76 (72%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP KEINE+LG V P+KF+RLALLS ++REK IQADI+GRREKL K+KS R + Sbjct: 1399 GLVPAFKEINERLGPVNPRKFARLALLSNEKREKVIQADIEGRREKLAKLKSTAVTKRRN 1458 Query: 805 KKSSSLRKVIRGEVPS 758 KS + K +R P+ Sbjct: 1459 TKSFRMNKFVRVSGPA 1474 >XP_006347554.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Solanum tuberosum] Length = 1476 Score = 85.9 bits (211), Expect = 1e-14 Identities = 44/76 (57%), Positives = 55/76 (72%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP KEINE+LG V P+KF+RLALLS ++REK IQADI+GRREKL K+KS R + Sbjct: 1400 GLVPAFKEINERLGPVNPRKFARLALLSNEKREKVIQADIEGRREKLAKLKSTAVTKRRN 1459 Query: 805 KKSSSLRKVIRGEVPS 758 KS + K +R P+ Sbjct: 1460 TKSFRMNKFVRVSGPA 1475 >XP_007029499.2 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Theobroma cacao] Length = 1458 Score = 85.5 bits (210), Expect = 1e-14 Identities = 44/68 (64%), Positives = 55/68 (80%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP K+I E+LG VRPKKF+RLALLS+DRREKAIQADI G +EKLEK+K+K G+ + + Sbjct: 1384 GLVPAFKDITERLGLVRPKKFARLALLSDDRREKAIQADIQGGKEKLEKLKTKVGY-KGA 1442 Query: 805 KKSSSLRK 782 + LRK Sbjct: 1443 RNIKKLRK 1450 >EOY10001.1 Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 1458 Score = 85.5 bits (210), Expect = 1e-14 Identities = 44/68 (64%), Positives = 55/68 (80%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP K+I E+LG VRPKKF+RLALLS+DRREKAIQADI G +EKLEK+K+K G+ + + Sbjct: 1384 GLVPAFKDITERLGLVRPKKFARLALLSDDRREKAIQADIQGGKEKLEKLKTKVGY-KGA 1442 Query: 805 KKSSSLRK 782 + LRK Sbjct: 1443 RNIKKLRK 1450 >XP_019253719.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Nicotiana attenuata] OIS98943.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 1460 Score = 85.1 bits (209), Expect = 2e-14 Identities = 42/79 (53%), Positives = 58/79 (73%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP ++INE+LG V P+KF+RLALLS+++REK IQADI+GRREKL K+K+ R + Sbjct: 1379 GLVPAFEDINERLGPVSPRKFARLALLSDEKREKVIQADIEGRREKLAKLKNTAVTTRKN 1438 Query: 805 KKSSSLRKVIRGEVPSIGN 749 KS ++K +R P+ N Sbjct: 1439 TKSFRMKKFVRVPGPAKSN 1457 >OAY44607.1 hypothetical protein MANES_08G165200 [Manihot esculenta] Length = 1480 Score = 85.1 bits (209), Expect = 2e-14 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP KEI E+LG VRPKKF++LALLS+DRR KAI+ADI GR+EKLEK+K+K R Sbjct: 1391 GLVPAFKEITEKLGFVRPKKFAKLALLSDDRRGKAIEADIQGRKEKLEKVKNKVELWRKK 1450 Query: 805 K-KSSSLRKVIRGEVPS 758 K + RK I+ VPS Sbjct: 1451 KIRKLRKRKPIQRVVPS 1467 >XP_008376869.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Malus domestica] Length = 1496 Score = 84.3 bits (207), Expect = 3e-14 Identities = 47/86 (54%), Positives = 62/86 (72%), Gaps = 1/86 (1%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP KEI E+LG VRPKKF+RLALLS+++REK I+ADI+GR+EKLEK+K K R S Sbjct: 1408 GLVPAFKEITEKLGLVRPKKFARLALLSDEKREKVIEADIEGRKEKLEKMKEKGEPRRVS 1467 Query: 805 K-KSSSLRKVIRGEVPSIGNIRSTKK 731 + K RK +R + + +I S +K Sbjct: 1468 RIKRLGKRKYVRPMLSNTKHIVSARK 1493 >XP_015878584.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Ziziphus jujuba] XP_015878585.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Ziziphus jujuba] XP_015878586.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Ziziphus jujuba] Length = 1485 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/72 (59%), Positives = 55/72 (76%), Gaps = 1/72 (1%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP K+I E+LG VRPKKF+RLALLS+++R+K IQADI+GR+EK+EK+K GF R Sbjct: 1409 GLVPAFKDITEKLGLVRPKKFARLALLSDEKRDKVIQADIEGRKEKMEKMKKNDGFGRMK 1468 Query: 805 K-KSSSLRKVIR 773 K K RK +R Sbjct: 1469 KMKKFMKRKYLR 1480 >XP_009361219.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Pyrus x bretschneideri] XP_009361220.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Pyrus x bretschneideri] Length = 1496 Score = 84.0 bits (206), Expect = 4e-14 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 1/86 (1%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GL+P KEI E+LG VRPKKF+RLALLS+++REK I+ADI+GR+EKLEK+K K R S Sbjct: 1408 GLIPAFKEITEKLGLVRPKKFARLALLSDEKREKVIEADIEGRKEKLEKMKEKGEPRRVS 1467 Query: 805 K-KSSSLRKVIRGEVPSIGNIRSTKK 731 + K RK +R + + +I S +K Sbjct: 1468 RIKRLGKRKYVRPMLSNTKHIVSVRK 1493 >XP_007206704.1 hypothetical protein PRUPE_ppa023974mg [Prunus persica] Length = 1353 Score = 83.6 bits (205), Expect = 6e-14 Identities = 45/87 (51%), Positives = 62/87 (71%), Gaps = 14/87 (16%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKS-------- 830 GLVP KEI E+LG VRPKKF+RLALLS+++REK IQ+DI+GR+EKLEK+K Sbjct: 1264 GLVPAFKEITERLGLVRPKKFARLALLSDEKREKVIQSDIEGRKEKLEKMKENDNPRRVS 1323 Query: 829 ------KRGFVRPSKKSSSLRKVIRGE 767 KR +VRPS S++ ++++ G+ Sbjct: 1324 RIKKLRKRKYVRPSTLSNT-KQIVSGQ 1349 >XP_009381612.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] XP_009381613.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] XP_018674760.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 1468 Score = 83.6 bits (205), Expect = 6e-14 Identities = 41/71 (57%), Positives = 56/71 (78%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP K+I+E+LG++RPKKF+RLALLSE+ R+K IQAD++GR+EK+EK+K K VR Sbjct: 1389 GLVPAFKDIHERLGQIRPKKFARLALLSEESRDKVIQADLEGRKEKMEKLKEK-AVVRSR 1447 Query: 805 KKSSSLRKVIR 773 K + RK +R Sbjct: 1448 KPTRFHRKYLR 1458 >XP_010318267.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Solanum lycopersicum] Length = 1475 Score = 83.6 bits (205), Expect = 6e-14 Identities = 42/76 (55%), Positives = 55/76 (72%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP KEINE+LG V P+KF+RLALLS ++REK IQADI+GRREKL K++S R + Sbjct: 1399 GLVPAFKEINERLGPVNPRKFARLALLSNEKREKVIQADIEGRREKLAKLRSTAVTKRRN 1458 Query: 805 KKSSSLRKVIRGEVPS 758 K+ + K +R P+ Sbjct: 1459 TKNFRMNKFVRVSGPA 1474 >ONI02054.1 hypothetical protein PRUPE_6G174500 [Prunus persica] Length = 1503 Score = 83.6 bits (205), Expect = 6e-14 Identities = 45/87 (51%), Positives = 62/87 (71%), Gaps = 14/87 (16%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKS-------- 830 GLVP KEI E+LG VRPKKF+RLALLS+++REK IQ+DI+GR+EKLEK+K Sbjct: 1414 GLVPAFKEITERLGLVRPKKFARLALLSDEKREKVIQSDIEGRKEKLEKMKENDNPRRVS 1473 Query: 829 ------KRGFVRPSKKSSSLRKVIRGE 767 KR +VRPS S++ ++++ G+ Sbjct: 1474 RIKKLRKRKYVRPSTLSNT-KQIVSGQ 1499 >XP_008245022.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] Length = 1503 Score = 83.6 bits (205), Expect = 6e-14 Identities = 45/87 (51%), Positives = 62/87 (71%), Gaps = 14/87 (16%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKS-------- 830 GLVP KEI E+LG VRPKKF+RLALLS+++REK IQ+DI+GR+EKLEK+K Sbjct: 1414 GLVPAFKEITERLGLVRPKKFARLALLSDEKREKVIQSDIEGRKEKLEKMKENDNPRRVS 1473 Query: 829 ------KRGFVRPSKKSSSLRKVIRGE 767 KR +VRPS S++ ++++ G+ Sbjct: 1474 RIKKLRKRKYVRPSTLSNT-KQIVSGQ 1499 >XP_016564170.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Capsicum annuum] Length = 1509 Score = 83.6 bits (205), Expect = 6e-14 Identities = 42/76 (55%), Positives = 55/76 (72%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP K+INE+LG V P+KF+RLALLS ++REK IQADI+GRREKL K++S R + Sbjct: 1433 GLVPAFKDINEKLGPVNPRKFARLALLSNEKREKVIQADIEGRREKLAKLESTAVAKRKN 1492 Query: 805 KKSSSLRKVIRGEVPS 758 KS + K +R P+ Sbjct: 1493 TKSFRMNKFVRVSGPA 1508 >XP_016481674.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Nicotiana tabacum] XP_016481675.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Nicotiana tabacum] Length = 1460 Score = 82.8 bits (203), Expect = 1e-13 Identities = 40/71 (56%), Positives = 55/71 (77%) Frame = -3 Query: 985 GLVPVLKEINEQLGEVRPKKFSRLALLSEDRREKAIQADIDGRREKLEKIKSKRGFVRPS 806 GLVP ++INE+LG V P+KF+RLALLS+++REK IQADI+GRREKL K+K+ R + Sbjct: 1379 GLVPAFEDINERLGPVGPRKFARLALLSDEKREKVIQADIEGRREKLAKMKNTAVTTRKN 1438 Query: 805 KKSSSLRKVIR 773 KS ++K +R Sbjct: 1439 TKSFRMKKFVR 1449