BLASTX nr result
ID: Papaver32_contig00035730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00035730 (537 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHG29485.1 UDP-arabinose 4-epimerase 1 [Gossypium arboreum] 62 3e-10 KHG29484.1 UDP-arabinose 4-epimerase 1 [Gossypium arboreum] 62 3e-10 JAU94931.1 Putative UDP-arabinose 4-epimerase 4 [Noccaea caerule... 62 3e-10 JAU25828.1 Putative UDP-arabinose 4-epimerase 4 [Noccaea caerule... 62 3e-10 XP_016754260.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium... 62 3e-10 XP_016732106.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Goss... 62 3e-10 XP_012451220.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium... 62 3e-10 XP_020167472.1 probable UDP-arabinose 4-epimerase 2 [Aegilops ta... 61 7e-10 EMT16191.1 Putative UDP-arabinose 4-epimerase 2 [Aegilops tauschii] 61 8e-10 XP_019087927.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 [... 60 1e-09 XP_002865365.1 predicted protein [Arabidopsis lyrata subsp. lyra... 60 1e-09 XP_018828567.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Jugl... 60 1e-09 AQK46214.1 NAD(P)-binding Rossmann-fold superfamily protein [Zea... 61 1e-09 XP_013675670.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 i... 60 1e-09 AQK46217.1 NAD(P)-binding Rossmann-fold superfamily protein [Zea... 61 1e-09 XP_013675673.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 i... 60 1e-09 NP_199261.1 NAD(P)-binding Rossmann-fold superfamily protein [Ar... 60 1e-09 XP_009393289.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 i... 60 1e-09 XP_009393290.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 i... 60 1e-09 NP_001169245.1 uncharacterized protein LOC100383103 [Zea mays] A... 61 1e-09 >KHG29485.1 UDP-arabinose 4-epimerase 1 [Gossypium arboreum] Length = 423 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQPSKVG Sbjct: 311 GTCIRDYIDVTDLVDAHVKALQKAQPSKVG 340 Score = 29.6 bits (65), Expect(2) = 3e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 350 RSVKEFVEACKKAT 363 >KHG29484.1 UDP-arabinose 4-epimerase 1 [Gossypium arboreum] Length = 418 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQPSKVG Sbjct: 306 GTCIRDYIDVTDLVDAHVKALQKAQPSKVG 335 Score = 29.6 bits (65), Expect(2) = 3e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 345 RSVKEFVEACKKAT 358 >JAU94931.1 Putative UDP-arabinose 4-epimerase 4 [Noccaea caerulescens] Length = 412 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQPSKVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALEKAQPSKVG 329 Score = 29.6 bits (65), Expect(2) = 3e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >JAU25828.1 Putative UDP-arabinose 4-epimerase 4 [Noccaea caerulescens] JAU46463.1 Putative UDP-arabinose 4-epimerase 4 [Noccaea caerulescens] JAU53636.1 Putative UDP-arabinose 4-epimerase 4 [Noccaea caerulescens] Length = 412 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQPSKVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALEKAQPSKVG 329 Score = 29.6 bits (65), Expect(2) = 3e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >XP_016754260.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium hirsutum] XP_016754262.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium hirsutum] XP_016754263.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium hirsutum] XP_016754264.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium hirsutum] XP_016754265.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium hirsutum] XP_016754266.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium hirsutum] XP_017643064.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium arboreum] XP_017643065.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium arboreum] XP_017643066.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium arboreum] XP_017643067.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium arboreum] Length = 412 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQPSKVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALQKAQPSKVG 329 Score = 29.6 bits (65), Expect(2) = 3e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >XP_016732106.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Gossypium hirsutum] XP_016732108.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Gossypium hirsutum] XP_016732109.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Gossypium hirsutum] XP_016732110.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Gossypium hirsutum] Length = 412 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQPSKVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALQKAQPSKVG 329 Score = 29.6 bits (65), Expect(2) = 3e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >XP_012451220.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] XP_012451222.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] XP_012451223.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] XP_012451224.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] XP_012451225.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] XP_012451226.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] KJB67991.1 hypothetical protein B456_010G220700 [Gossypium raimondii] KJB67992.1 hypothetical protein B456_010G220700 [Gossypium raimondii] KJB67993.1 hypothetical protein B456_010G220700 [Gossypium raimondii] Length = 412 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQPSKVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALQKAQPSKVG 329 Score = 29.6 bits (65), Expect(2) = 3e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >XP_020167472.1 probable UDP-arabinose 4-epimerase 2 [Aegilops tauschii subsp. tauschii] Length = 412 Score = 60.8 bits (146), Expect(2) = 7e-10 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTC+RDYIDVTDLVDAHVKAL KA+PSKVG Sbjct: 300 GTCVRDYIDVTDLVDAHVKALGKAEPSKVG 329 Score = 29.6 bits (65), Expect(2) = 7e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >EMT16191.1 Putative UDP-arabinose 4-epimerase 2 [Aegilops tauschii] Length = 355 Score = 60.8 bits (146), Expect(2) = 8e-10 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTC+RDYIDVTDLVDAHVKAL KA+PSKVG Sbjct: 243 GTCVRDYIDVTDLVDAHVKALGKAEPSKVG 272 Score = 29.6 bits (65), Expect(2) = 8e-10 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 282 RSVKEFVEACKKAT 295 >XP_019087927.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 [Camelina sativa] XP_019087928.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 [Camelina sativa] Length = 412 Score = 60.5 bits (145), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALEKAQPQKVG 329 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >XP_002865365.1 predicted protein [Arabidopsis lyrata subsp. lyrata] EFH41624.1 predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 412 Score = 60.5 bits (145), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALVKAQPRKVG 329 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >XP_018828567.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Juglans regia] Length = 409 Score = 60.5 bits (145), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALEKAQPKKVG 329 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >AQK46214.1 NAD(P)-binding Rossmann-fold superfamily protein [Zea mays] Length = 505 Score = 60.8 bits (146), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 393 GTCIRDYIDVTDLVDAHVKALGKAQPGKVG 422 Score = 28.9 bits (63), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS+ EFVEACKKAT Sbjct: 432 RSVTEFVEACKKAT 445 >XP_013675670.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 isoform X1 [Brassica napus] XP_013675671.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 isoform X1 [Brassica napus] XP_013675672.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 isoform X1 [Brassica napus] Length = 476 Score = 60.1 bits (144), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALEKAQPHKVG 329 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >AQK46217.1 NAD(P)-binding Rossmann-fold superfamily protein [Zea mays] Length = 439 Score = 60.8 bits (146), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 327 GTCIRDYIDVTDLVDAHVKALGKAQPGKVG 356 Score = 28.9 bits (63), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS+ EFVEACKKAT Sbjct: 366 RSVTEFVEACKKAT 379 >XP_013675673.1 PREDICTED: putative UDP-arabinose 4-epimerase 4 isoform X2 [Brassica napus] Length = 438 Score = 60.1 bits (144), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALEKAQPHKVG 329 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >NP_199261.1 NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis thaliana] Q9FI17.1 RecName: Full=Putative UDP-arabinose 4-epimerase 4; AltName: Full=UDP-D-xylose 4-epimerase 4 BAB09155.1 unnamed protein product [Arabidopsis thaliana] AED95113.1 NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis thaliana] Length = 436 Score = 60.1 bits (144), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 324 GTCIRDYIDVTDLVDAHVKALEKAQPRKVG 353 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 363 RSVKEFVEACKKAT 376 >XP_009393289.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X1 [Musa acuminata subsp. malaccensis] XP_018679608.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X1 [Musa acuminata subsp. malaccensis] XP_018679609.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X1 [Musa acuminata subsp. malaccensis] XP_018679610.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X1 [Musa acuminata subsp. malaccensis] Length = 423 Score = 60.1 bits (144), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KA+PSKVG Sbjct: 306 GTCIRDYIDVTDLVDAHVKALDKAKPSKVG 335 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 345 RSVKEFVEACKKAT 358 >XP_009393290.1 PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 417 Score = 60.1 bits (144), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KA+PSKVG Sbjct: 300 GTCIRDYIDVTDLVDAHVKALDKAKPSKVG 329 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS++EFVEACKKAT Sbjct: 339 RSVKEFVEACKKAT 352 >NP_001169245.1 uncharacterized protein LOC100383103 [Zea mays] ACN32068.1 unknown [Zea mays] Length = 415 Score = 60.8 bits (146), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 537 GTCIRDYIDVTDLVDAHVKALAKAQPSKVG 448 GTCIRDYIDVTDLVDAHVKAL KAQP KVG Sbjct: 303 GTCIRDYIDVTDLVDAHVKALGKAQPGKVG 332 Score = 28.9 bits (63), Expect(2) = 1e-09 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 439 RSIEEFVEACKKAT 398 RS+ EFVEACKKAT Sbjct: 342 RSVTEFVEACKKAT 355