BLASTX nr result
ID: Papaver32_contig00035428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00035428 (970 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010096986.1 hypothetical protein L484_024909 [Morus notabilis... 40 7e-06 XP_010097002.1 hypothetical protein L484_024925 [Morus notabilis... 40 7e-06 >XP_010096986.1 hypothetical protein L484_024909 [Morus notabilis] EXB66613.1 hypothetical protein L484_024909 [Morus notabilis] Length = 461 Score = 39.7 bits (91), Expect(2) = 7e-06 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 781 IRYEKLPCLCYFCGFFGHQMNKCP 710 +RYEKLP CY CG FGH +CP Sbjct: 198 LRYEKLPDFCYGCGKFGHGTRECP 221 Score = 39.3 bits (90), Expect(2) = 7e-06 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -2 Query: 924 GNPFPISEDDAAK-WGKYARVRVQIDITKPLPKEMPVTL 811 G+ + +DD + WG+Y RVRV +DITKP+ +++ + L Sbjct: 149 GSTVSVQQDDKGRCWGQYVRVRVVLDITKPIRRQVKIIL 187 >XP_010097002.1 hypothetical protein L484_024925 [Morus notabilis] EXB66629.1 hypothetical protein L484_024925 [Morus notabilis] Length = 341 Score = 39.7 bits (91), Expect(2) = 7e-06 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 781 IRYEKLPCLCYFCGFFGHQMNKCP 710 +RYEKLP CY CG FGH +CP Sbjct: 198 LRYEKLPDFCYGCGKFGHGTRECP 221 Score = 39.3 bits (90), Expect(2) = 7e-06 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -2 Query: 924 GNPFPISEDDAAK-WGKYARVRVQIDITKPLPKEMPVTL 811 G+ + +DD + WG+Y RVRV +DITKP+ +++ + L Sbjct: 149 GSTVSVQQDDKGRCWGQYVRVRVVLDITKPIRRQVKIIL 187