BLASTX nr result
ID: Papaver32_contig00035255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00035255 (673 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010096826.1 Endoglucanase 6 [Morus notabilis] EXB66086.1 Endo... 57 7e-08 AAG31636.1 endo-beta-1,4-D-glucanase, partial [Solanum lycopersi... 53 2e-06 XP_018815553.1 PREDICTED: endoglucanase 6-like [Juglans regia] 58 3e-06 OMP02983.1 Glycoside hydrolase, family 9 [Corchorus olitorius] 58 3e-06 OMO79718.1 Glycoside hydrolase, family 9 [Corchorus capsularis] 58 3e-06 XP_016555781.1 PREDICTED: endoglucanase 6-like [Capsicum annuum] 58 3e-06 XP_018846387.1 PREDICTED: endoglucanase 6-like [Juglans regia] 58 3e-06 >XP_010096826.1 Endoglucanase 6 [Morus notabilis] EXB66086.1 Endoglucanase 6 [Morus notabilis] Length = 58 Score = 57.4 bits (137), Expect = 7e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 399 SWLTSLPAGKSMEFVYIHANTPAAVSVSSYTLA 301 SWL SLP+GKS+EFVYIH+ +PA VSVSSYTLA Sbjct: 26 SWLNSLPSGKSLEFVYIHSTSPADVSVSSYTLA 58 >AAG31636.1 endo-beta-1,4-D-glucanase, partial [Solanum lycopersicum] Length = 43 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = -2 Query: 399 SWLTSLPAGKSMEFVYIH-ANTPAAVSVSSYTL 304 +W+ SLP GKS+EFVYIH AN+PA VSVSSYTL Sbjct: 10 AWINSLPTGKSLEFVYIHTANSPAVVSVSSYTL 42 >XP_018815553.1 PREDICTED: endoglucanase 6-like [Juglans regia] Length = 625 Score = 58.2 bits (139), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 399 SWLTSLPAGKSMEFVYIHANTPAAVSVSSYTLA 301 SWL SLPAGKS+EFVYIH+ +PA VSVSSYTLA Sbjct: 593 SWLNSLPAGKSLEFVYIHSASPAEVSVSSYTLA 625 >OMP02983.1 Glycoside hydrolase, family 9 [Corchorus olitorius] Length = 631 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 399 SWLTSLPAGKSMEFVYIHANTPAAVSVSSYTLA 301 SW+ SLPAGKS+EFVYIH+ TPA VSVSSY LA Sbjct: 599 SWINSLPAGKSLEFVYIHSTTPAVVSVSSYNLA 631 >OMO79718.1 Glycoside hydrolase, family 9 [Corchorus capsularis] Length = 640 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 399 SWLTSLPAGKSMEFVYIHANTPAAVSVSSYTLA 301 SW+ SLPAGKS+EFVYIH+ TPA VSVSSY LA Sbjct: 608 SWINSLPAGKSLEFVYIHSTTPAVVSVSSYNLA 640 >XP_016555781.1 PREDICTED: endoglucanase 6-like [Capsicum annuum] Length = 623 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 399 SWLTSLPAGKSMEFVYIHANTPAAVSVSSYTLA 301 SWL SLPAGKS+EFVYIH +PA VSVSSYTLA Sbjct: 591 SWLNSLPAGKSLEFVYIHTASPAIVSVSSYTLA 623 >XP_018846387.1 PREDICTED: endoglucanase 6-like [Juglans regia] Length = 626 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 399 SWLTSLPAGKSMEFVYIHANTPAAVSVSSYTLA 301 SWL SLPAGKS+EFVYIH+ +PA VSVSSYTLA Sbjct: 594 SWLNSLPAGKSLEFVYIHSASPADVSVSSYTLA 626