BLASTX nr result
ID: Papaver32_contig00035053
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00035053 (854 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACT65860.1 elongation factor 1, partial [Elettaria cardamomum] 91 4e-20 ABL98118.1 elongation factor 1-alpha, partial [Euphorbia pulcher... 91 9e-20 AKT44442.1 elongation factor-1 alpha, partial [Aegiceras floridum] 91 1e-19 AQL04302.1 elongation factor 1-alpha9 [Zea mays] 91 2e-19 AEQ16457.1 elongation factor 1 alpha, partial [Musa AAB Group] 91 2e-19 ADX43889.1 elongation factor, partial [Piper nigrum] 89 2e-19 AHH02377.1 elongation factor 1-alpha, partial [Aegiceras cornicu... 91 3e-19 AFK35720.1 unknown [Medicago truncatula] 91 3e-19 KRX11977.1 Elongation factor 1-alpha, partial [Trichinella nelsoni] 91 3e-19 AQL04305.1 elongation factor 1-alpha9 [Zea mays] 91 4e-19 AQK85081.1 elongation factor alpha3 [Zea mays] AQK85093.1 elonga... 91 4e-19 AJD73562.1 elongation 1-alpha factor, partial [Chrysolaena obovata] 91 4e-19 ACN59920.1 translation elongation factor-1 alpha, partial [Ernod... 89 4e-19 ACN59925.1 translation elongation factor-1 alpha, partial [Spiro... 89 5e-19 KJB73625.1 hypothetical protein B456_011G2412001, partial [Gossy... 91 5e-19 BAJ91931.1 predicted protein [Hordeum vulgare subsp. vulgare] 91 5e-19 XP_016508315.1 PREDICTED: elongation factor 1-alpha-like [Nicoti... 91 5e-19 BAA76426.1 translation elongation factor, partial [Cicer arietinum] 91 5e-19 KRY04835.1 Elongation factor 1-alpha, partial [Trichinella patag... 91 5e-19 AGH32904.1 translation elongation factor 1-alpha, partial [Camel... 91 5e-19 >ACT65860.1 elongation factor 1, partial [Elettaria cardamomum] Length = 56 Score = 90.9 bits (224), Expect = 4e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 3 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 44 >ABL98118.1 elongation factor 1-alpha, partial [Euphorbia pulcherrima] Length = 85 Score = 90.9 bits (224), Expect = 9e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 29 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 70 >AKT44442.1 elongation factor-1 alpha, partial [Aegiceras floridum] Length = 97 Score = 90.9 bits (224), Expect = 1e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 2 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 43 >AQL04302.1 elongation factor 1-alpha9 [Zea mays] Length = 102 Score = 90.9 bits (224), Expect = 2e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 59 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 100 >AEQ16457.1 elongation factor 1 alpha, partial [Musa AAB Group] Length = 111 Score = 90.9 bits (224), Expect = 2e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 38 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 79 >ADX43889.1 elongation factor, partial [Piper nigrum] Length = 55 Score = 89.0 bits (219), Expect = 2e-19 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYC VIDAPGHRDFIK Sbjct: 3 VLDKLKAERERGITIDIALWKFETTKYYCAVIDAPGHRDFIK 44 >AHH02377.1 elongation factor 1-alpha, partial [Aegiceras corniculatum] Length = 122 Score = 90.9 bits (224), Expect = 3e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 2 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 43 >AFK35720.1 unknown [Medicago truncatula] Length = 126 Score = 90.9 bits (224), Expect = 3e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 59 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 100 >KRX11977.1 Elongation factor 1-alpha, partial [Trichinella nelsoni] Length = 132 Score = 90.9 bits (224), Expect = 3e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 33 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 74 >AQL04305.1 elongation factor 1-alpha9 [Zea mays] Length = 136 Score = 90.9 bits (224), Expect = 4e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 59 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 100 >AQK85081.1 elongation factor alpha3 [Zea mays] AQK85093.1 elongation factor alpha2 [Zea mays] AQK85105.1 Elongation factor 1-alpha [Zea mays] AQK92866.1 Elongation factor 1-alpha [Zea mays] Length = 136 Score = 90.9 bits (224), Expect = 4e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 59 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 100 >AJD73562.1 elongation 1-alpha factor, partial [Chrysolaena obovata] Length = 137 Score = 90.9 bits (224), Expect = 4e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 29 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 70 >ACN59920.1 translation elongation factor-1 alpha, partial [Ernodesmis verticillata] Length = 68 Score = 88.6 bits (218), Expect = 4e-19 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIK Sbjct: 1 VLDKLKAERERGITIDIALWKFETPKYYCTVIDAPGHRDFIK 42 >ACN59925.1 translation elongation factor-1 alpha, partial [Spirogyra sp. 169.80] Length = 81 Score = 89.0 bits (219), Expect = 5e-19 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIK Sbjct: 14 VLDKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIK 55 >KJB73625.1 hypothetical protein B456_011G2412001, partial [Gossypium raimondii] Length = 144 Score = 90.9 bits (224), Expect = 5e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 59 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 100 >BAJ91931.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 144 Score = 90.9 bits (224), Expect = 5e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 59 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 100 >XP_016508315.1 PREDICTED: elongation factor 1-alpha-like [Nicotiana tabacum] Length = 145 Score = 90.9 bits (224), Expect = 5e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 59 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 100 >BAA76426.1 translation elongation factor, partial [Cicer arietinum] Length = 147 Score = 90.9 bits (224), Expect = 5e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 41 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 82 >KRY04835.1 Elongation factor 1-alpha, partial [Trichinella patagoniensis] Length = 149 Score = 90.9 bits (224), Expect = 5e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 11 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 52 >AGH32904.1 translation elongation factor 1-alpha, partial [Camellia oleifera] Length = 149 Score = 90.9 bits (224), Expect = 5e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 728 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 853 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK Sbjct: 59 VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIK 100