BLASTX nr result
ID: Papaver32_contig00034708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00034708 (517 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI02071.1 F-box associated domain, type 1 [Cynara cardunculus v... 55 6e-06 >KVI02071.1 F-box associated domain, type 1 [Cynara cardunculus var. scolymus] Length = 385 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/62 (41%), Positives = 38/62 (61%) Frame = -2 Query: 393 MESLPSDALLNILSRVPTESVFECKLVCKKWPTLIHQSGNYFADMHLRHQINHMYGGGNS 214 ME LP D + ++LSR+P +++ CKLVCKKW L+ S YF ++HL + NS Sbjct: 1 MEELPPDVMADVLSRLPVKTIIHCKLVCKKWQNLVLDS--YFVNLHLSKSPPSLVIHHNS 58 Query: 213 EE 208 E+ Sbjct: 59 EK 60