BLASTX nr result
ID: Papaver32_contig00034534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00034534 (1899 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006442448.1 hypothetical protein CICLE_v10022947mg [Citrus cl... 60 1e-07 KDO41443.1 hypothetical protein CISIN_1g046166mg [Citrus sinensis] 57 2e-06 EOY13337.1 Uncharacterized protein TCM_031878 [Theobroma cacao] 57 3e-06 >XP_006442448.1 hypothetical protein CICLE_v10022947mg [Citrus clementina] ESR55688.1 hypothetical protein CICLE_v10022947mg [Citrus clementina] KDO40711.1 hypothetical protein CISIN_1g036709mg [Citrus sinensis] Length = 112 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 1661 KTVSDKLLGKFCDDLSH-FDHECSGL*SPPVERDVYLGSNDRICTQDEIIIKIK 1503 K+VSD+LLGKF D L + FD+E SGL SPPV R VYL S ++C+ DE+ K+K Sbjct: 40 KSVSDRLLGKFFDALQYDFDYEQSGLWSPPVPRKVYLNSPGKMCSDDEMFSKLK 93 >KDO41443.1 hypothetical protein CISIN_1g046166mg [Citrus sinensis] Length = 105 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -2 Query: 1661 KTVSDKLLGKFCDDLSH-FDHECSGL*SPPVERDVYLGSNDRICTQDEIIIKIK 1503 K VSD+L GKF D L + F++E SGL SPPV R VYL S +IC+ DE+ K+K Sbjct: 33 KLVSDRLQGKFFDALQYDFEYEQSGLWSPPVPRKVYLNSPGKICSDDEMFSKLK 86 >EOY13337.1 Uncharacterized protein TCM_031878 [Theobroma cacao] Length = 146 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -2 Query: 1661 KTVSDKLLGKFCDDLSH-FDHECSGL*SPPVERDVYLGSNDRICTQDEIIIKIK 1503 KTVS++LLGKF D + FD+E SGL SPPV R V+L S IC++DE K+K Sbjct: 29 KTVSERLLGKFFDASQYDFDYEQSGLWSPPVRRSVFLTSPGNICSEDEFFSKLK 82