BLASTX nr result
ID: Papaver32_contig00034174
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00034174 (420 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN01835.1 B3 domain-containing transcription factor VRN1 [Glyci... 71 1e-12 XP_018826360.1 PREDICTED: B3 domain-containing transcription fac... 72 4e-12 KRH46517.1 hypothetical protein GLYMA_08G339100 [Glycine max] 71 4e-12 XP_014634017.1 PREDICTED: B3 domain-containing transcription fac... 71 7e-12 XP_010263798.1 PREDICTED: B3 domain-containing transcription fac... 65 1e-11 XP_010263799.1 PREDICTED: B3 domain-containing transcription fac... 65 1e-11 GAV91357.1 B3 domain-containing protein [Cephalotus follicularis] 71 1e-11 XP_019078510.1 PREDICTED: B3 domain-containing transcription fac... 70 2e-11 XP_018826361.1 PREDICTED: uncharacterized protein LOC108995281 [... 70 3e-11 XP_018828948.1 PREDICTED: B3 domain-containing transcription fac... 63 3e-11 XP_015890081.1 PREDICTED: B3 domain-containing protein Os03g0620... 69 4e-11 XP_007140766.1 hypothetical protein PHAVU_008G140100g, partial [... 66 5e-11 CBI40975.3 unnamed protein product, partial [Vitis vinifera] 69 7e-11 XP_019076545.1 PREDICTED: putative B3 domain-containing protein ... 69 9e-11 XP_019078477.1 PREDICTED: B3 domain-containing transcription fac... 68 1e-10 CAN65918.1 hypothetical protein VITISV_028778 [Vitis vinifera] 68 1e-10 CAN71750.1 hypothetical protein VITISV_040593 [Vitis vinifera] 68 1e-10 XP_010681213.1 PREDICTED: putative B3 domain-containing protein ... 67 2e-10 XP_012072574.1 PREDICTED: uncharacterized protein LOC105634339 [... 60 3e-10 KDP46179.1 hypothetical protein JCGZ_10019 [Jatropha curcas] 60 3e-10 >KHN01835.1 B3 domain-containing transcription factor VRN1 [Glycine soja] Length = 175 Score = 70.9 bits (172), Expect = 1e-12 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPLH 198 K G ++F GWKDF +Y++LA H L +YDG S FH+F+CDM+ EI+YP++ Sbjct: 70 KRDGSVWFQEGWKDFAEYYSLANGHLLGFRYDGTSHFHVFICDMSTMEIEYPVN 123 >XP_018826360.1 PREDICTED: B3 domain-containing transcription factor VRN1-like [Juglans regia] Length = 509 Score = 72.4 bits (176), Expect = 4e-12 Identities = 27/51 (52%), Positives = 41/51 (80%) Frame = -2 Query: 350 GEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPLH 198 GEI+ +GW++FM+Y+++ HFL+ +Y+GNSRFHI + DM+A+EI YP H Sbjct: 72 GEIWLQKGWQEFMEYYSVKPGHFLVFRYEGNSRFHILIFDMSATEIDYPTH 122 >KRH46517.1 hypothetical protein GLYMA_08G339100 [Glycine max] Length = 256 Score = 70.9 bits (172), Expect = 4e-12 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPLH 198 K G ++F GWKDF +Y++LA H L +YDG S FH+F+CDM+ EI+YP++ Sbjct: 70 KRDGSVWFQEGWKDFAEYYSLANGHLLGFRYDGTSHFHVFICDMSTMEIEYPVN 123 >XP_014634017.1 PREDICTED: B3 domain-containing transcription factor VRN1-like [Glycine max] Length = 296 Score = 70.9 bits (172), Expect = 7e-12 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPLH 198 K G ++F GWKDF +Y++LA H L +YDG S FH+F+CDM+ EI+YP++ Sbjct: 83 KRDGSVWFQEGWKDFAEYYSLANGHLLGFRYDGTSHFHVFICDMSTMEIEYPVN 136 >XP_010263798.1 PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1 [Nelumbo nucifera] Length = 382 Score = 65.5 bits (158), Expect(2) = 1e-11 Identities = 24/52 (46%), Positives = 39/52 (75%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 K G+++F +GW++F++Y +L H L+ +Y+GNS FH+ + D TASEI+YP Sbjct: 72 KVNGKLWFQKGWQEFVEYHSLGEGHVLVFRYEGNSHFHVLIFDTTASEIEYP 123 Score = 31.2 bits (69), Expect(2) = 1e-11 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQL 359 LS VAV+T+P+G+VWR+ L Sbjct: 52 LSTVAVLTVPSGKVWRIGL 70 >XP_010263799.1 PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X2 [Nelumbo nucifera] Length = 376 Score = 65.5 bits (158), Expect(2) = 1e-11 Identities = 24/52 (46%), Positives = 39/52 (75%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 K G+++F +GW++F++Y +L H L+ +Y+GNS FH+ + D TASEI+YP Sbjct: 72 KVNGKLWFQKGWQEFVEYHSLGEGHVLVFRYEGNSHFHVLIFDTTASEIEYP 123 Score = 31.2 bits (69), Expect(2) = 1e-11 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQL 359 LS VAV+T+P+G+VWR+ L Sbjct: 52 LSTVAVLTVPSGKVWRIGL 70 >GAV91357.1 B3 domain-containing protein [Cephalotus follicularis] Length = 560 Score = 70.9 bits (172), Expect = 1e-11 Identities = 27/54 (50%), Positives = 42/54 (77%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPLH 198 K GE++ GW++F +Y+++A++HFL+ KY+GNS F + + DM+ASEIKYP H Sbjct: 64 KCNGEVWLQNGWQEFKEYYSIALNHFLVFKYEGNSCFSVVIFDMSASEIKYPYH 117 >XP_019078510.1 PREDICTED: B3 domain-containing transcription factor VRN1-like [Vitis vinifera] Length = 326 Score = 70.1 bits (170), Expect = 2e-11 Identities = 26/53 (49%), Positives = 40/53 (75%) Frame = -2 Query: 362 VKPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 +K GE+ FG GW+ F D++++ HFL+ +Y+G+S FH+ + DMTASEI+YP Sbjct: 56 LKLHGEVLFGSGWQRFADFYSIGYGHFLLFRYEGSSHFHVLIFDMTASEIEYP 108 >XP_018826361.1 PREDICTED: uncharacterized protein LOC108995281 [Juglans regia] Length = 1379 Score = 69.7 bits (169), Expect(2) = 3e-11 Identities = 23/51 (45%), Positives = 41/51 (80%) Frame = -2 Query: 350 GEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPLH 198 GE++ +GW++F++Y+++ HFL+ +Y+GNSRFH+ + DM+A+E+ YP H Sbjct: 72 GELWLQKGWQEFLEYYSVKPGHFLVFRYEGNSRFHVLIFDMSATEVDYPTH 122 Score = 25.4 bits (54), Expect(2) = 3e-11 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQLS 356 LS++A + +PNG W+++L+ Sbjct: 49 LSNLAFLNLPNGAEWKLELT 68 Score = 58.2 bits (139), Expect(2) = 4e-08 Identities = 22/54 (40%), Positives = 38/54 (70%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPLH 198 K GE++ +GW++F++Y +L + HFL+ +Y+G S F + V D +A+EI YP + Sbjct: 624 KCDGEVWLKKGWREFVEYSSLKLGHFLVFRYEGKSHFCVLVFDESATEIDYPFN 677 Score = 26.6 bits (57), Expect(2) = 4e-08 Identities = 9/20 (45%), Positives = 17/20 (85%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQLS 356 LS++A+I +PNG W+++L+ Sbjct: 604 LSNLALIKLPNGAEWKLELA 623 >XP_018828948.1 PREDICTED: B3 domain-containing transcription factor VRN1-like [Juglans regia] Length = 313 Score = 63.2 bits (152), Expect(2) = 3e-11 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = -2 Query: 347 EIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 +I+F GW+DF++Y ++ +FL+ KY GNS FH+ + DMTA+EI YP Sbjct: 86 KIWFREGWQDFVEYLSIQQGYFLVFKYKGNSSFHVLIFDMTATEIHYP 133 Score = 32.0 bits (71), Expect(2) = 3e-11 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQL 359 LS VAV+T+PNG VWRV L Sbjct: 62 LSTVAVLTVPNGCVWRVGL 80 >XP_015890081.1 PREDICTED: B3 domain-containing protein Os03g0620500-like [Ziziphus jujuba] Length = 766 Score = 69.3 bits (168), Expect = 4e-11 Identities = 27/64 (42%), Positives = 46/64 (71%), Gaps = 3/64 (4%) Frame = -2 Query: 380 SGLACTVKPK---GEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIK 210 SG+ ++P+ GE++ +GW +F +Y++L HFL+ +Y+GNSRFH+ + D TA+EI Sbjct: 47 SGVEWNIEPEICGGEVWLQKGWPEFANYYSLEQGHFLVFRYEGNSRFHVIIFDATATEID 106 Query: 209 YPLH 198 YP++ Sbjct: 107 YPIN 110 >XP_007140766.1 hypothetical protein PHAVU_008G140100g, partial [Phaseolus vulgaris] ESW12760.1 hypothetical protein PHAVU_008G140100g, partial [Phaseolus vulgaris] Length = 160 Score = 66.2 bits (160), Expect = 5e-11 Identities = 24/54 (44%), Positives = 38/54 (70%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPLH 198 K G ++F +GWK+F++Y LA H L+ +Y+G S FH+ +CDM+ EI YP++ Sbjct: 70 KSDGSVWFQQGWKEFVEYHCLAHGHLLVFRYNGTSHFHVLICDMSCMEIDYPVN 123 >CBI40975.3 unnamed protein product, partial [Vitis vinifera] Length = 399 Score = 68.6 bits (166), Expect = 7e-11 Identities = 25/49 (51%), Positives = 39/49 (79%) Frame = -2 Query: 350 GEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 GE++ GW++F++Y+++ HFL+ +Y+GNS FHI + DMTASEI+YP Sbjct: 69 GEVWLDGGWREFVEYYSIGYGHFLVFRYEGNSIFHILIFDMTASEIEYP 117 >XP_019076545.1 PREDICTED: putative B3 domain-containing protein Os03g0621600 [Vitis vinifera] Length = 1030 Score = 68.6 bits (166), Expect = 9e-11 Identities = 25/49 (51%), Positives = 39/49 (79%) Frame = -2 Query: 350 GEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 GE++ GW++F++Y+++ HFL+ +Y+GNS FHI + DMTASEI+YP Sbjct: 295 GEVWLDGGWREFVEYYSIGYGHFLVFRYEGNSIFHILIFDMTASEIEYP 343 Score = 58.2 bits (139), Expect(2) = 1e-07 Identities = 21/53 (39%), Positives = 36/53 (67%) Frame = -2 Query: 362 VKPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 +K E GW++F +++++ H L+ +Y+G+S FH+ + DMTASEI+YP Sbjct: 693 MKRHDEALLQGGWQEFCEFYSIGYGHLLLFRYEGDSHFHVLIFDMTASEIEYP 745 Score = 24.6 bits (52), Expect(2) = 1e-07 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQL 359 LS V + +P+G WRV+L Sbjct: 674 LSSVVFLKVPSGAQWRVEL 692 >XP_019078477.1 PREDICTED: B3 domain-containing transcription factor VRN1-like [Vitis vinifera] Length = 315 Score = 67.8 bits (164), Expect = 1e-10 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = -2 Query: 362 VKPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 +K GE+ F GW+ F D++++ HFL+ +Y+G+S FH+ + DMTASEI+YP Sbjct: 46 LKLHGEVLFSSGWQRFADFYSIGYGHFLLFRYEGSSHFHVLIFDMTASEIEYP 98 >CAN65918.1 hypothetical protein VITISV_028778 [Vitis vinifera] Length = 352 Score = 67.8 bits (164), Expect = 1e-10 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = -2 Query: 362 VKPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 +K GE+ F GW+ F D++++ HFL+ +Y+G+S FH+ + DMTASEI+YP Sbjct: 119 LKLHGEVLFSTGWQRFADFYSIGYGHFLLFRYEGSSHFHVLIFDMTASEIEYP 171 >CAN71750.1 hypothetical protein VITISV_040593 [Vitis vinifera] Length = 617 Score = 67.8 bits (164), Expect = 1e-10 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = -2 Query: 362 VKPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 +K GE+ F GW+ F D++++ HFL+ +Y+G+S FH+ + DMTASEI+YP Sbjct: 46 LKLHGEVLFSSGWQRFADFYSIGYGHFLLFRYEGSSHFHVLIFDMTASEIEYP 98 Score = 65.1 bits (157), Expect = 1e-09 Identities = 24/53 (45%), Positives = 40/53 (75%) Frame = -2 Query: 362 VKPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 +K GE+ F GW+ F++++++ +FL+ +Y+G+S FH+ V DMTASEI+YP Sbjct: 337 LKLHGEVLFSTGWQQFVEHYSIEYGYFLLFRYEGDSHFHVLVFDMTASEIEYP 389 >XP_010681213.1 PREDICTED: putative B3 domain-containing protein Os03g0621600 [Beta vulgaris subsp. vulgaris] Length = 369 Score = 66.6 bits (161), Expect(2) = 2e-10 Identities = 25/54 (46%), Positives = 40/54 (74%) Frame = -2 Query: 362 VKPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYPL 201 V+ G+ F +GW +F++++ L HFL+ KY+G SRF + +CDM+ASEI+YP+ Sbjct: 135 VRGNGKAFLQKGWPEFVEFYLLKHGHFLMFKYEGKSRFDVVICDMSASEIEYPI 188 Score = 25.8 bits (55), Expect(2) = 2e-10 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQL 359 LS+ + IP GQVW++ L Sbjct: 116 LSNTIYLNIPTGQVWKINL 134 >XP_012072574.1 PREDICTED: uncharacterized protein LOC105634339 [Jatropha curcas] Length = 855 Score = 60.5 bits (145), Expect(2) = 3e-10 Identities = 21/52 (40%), Positives = 39/52 (75%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 K G+++F GW +F++Y+++ + +FL+ KY G+S F+ ++ D+T SEI+YP Sbjct: 68 KKDGKLWFHNGWHEFVEYYSVRLGYFLVFKYGGDSNFNTYIFDLTVSEIRYP 119 Score = 31.6 bits (70), Expect(2) = 3e-10 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQLSLK 350 LS +A +T+PNG++W V+L K Sbjct: 48 LSSIATLTVPNGRIWLVELEKK 69 >KDP46179.1 hypothetical protein JCGZ_10019 [Jatropha curcas] Length = 402 Score = 60.5 bits (145), Expect(2) = 3e-10 Identities = 21/52 (40%), Positives = 39/52 (75%) Frame = -2 Query: 359 KPKGEIFFGRGWKDFMDYFTLAVSHFLILKYDGNSRFHIFVCDMTASEIKYP 204 K G+++F GW +F++Y+++ + +FL+ KY G+S F+ ++ D+T SEI+YP Sbjct: 68 KKDGKLWFHNGWHEFVEYYSVRLGYFLVFKYGGDSNFNTYIFDLTVSEIRYP 119 Score = 31.6 bits (70), Expect(2) = 3e-10 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -3 Query: 415 LSDVAVITIPNGQVWRVQLSLK 350 LS +A +T+PNG++W V+L K Sbjct: 48 LSSIATLTVPNGRIWLVELEKK 69