BLASTX nr result
ID: Papaver32_contig00033953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00033953 (405 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH67395.1 hypothetical protein GLYMA_03G163900 [Glycine max] 60 9e-08 KRH67392.1 hypothetical protein GLYMA_03G163900 [Glycine max] 60 9e-08 XP_014629316.1 PREDICTED: U-box domain-containing protein 3-like... 60 9e-08 KHN02500.1 U-box domain-containing protein 3 [Glycine soja] 58 3e-07 KRG95671.1 hypothetical protein GLYMA_19G165200 [Glycine max] 58 3e-07 XP_006604492.1 PREDICTED: U-box domain-containing protein 3-like... 58 3e-07 XP_010101417.1 U-box domain-containing protein 3 [Morus notabili... 58 3e-07 KRG95673.1 hypothetical protein GLYMA_19G165200 [Glycine max] 58 3e-07 KYP70744.1 U-box domain-containing protein 3, partial [Cajanus c... 57 6e-07 KJB11338.1 hypothetical protein B456_001G254100 [Gossypium raimo... 57 7e-07 XP_016746707.1 PREDICTED: U-box domain-containing protein 3-like... 57 7e-07 XP_016749956.1 PREDICTED: U-box domain-containing protein 3-like... 57 7e-07 XP_012442835.1 PREDICTED: U-box domain-containing protein 3-like... 57 7e-07 EOX94436.1 ARM repeat superfamily protein isoform 2 [Theobroma c... 57 8e-07 XP_016746705.1 PREDICTED: U-box domain-containing protein 3-like... 57 8e-07 XP_016749955.1 PREDICTED: U-box domain-containing protein 3-like... 57 8e-07 XP_012442820.1 PREDICTED: U-box domain-containing protein 3-like... 57 8e-07 XP_017613477.1 PREDICTED: U-box domain-containing protein 3-like... 57 8e-07 XP_017976788.1 PREDICTED: U-box domain-containing protein 3 [The... 57 8e-07 EOX94435.1 ARM repeat superfamily protein isoform 1 [Theobroma c... 57 8e-07 >KRH67395.1 hypothetical protein GLYMA_03G163900 [Glycine max] Length = 760 Score = 59.7 bits (143), Expect = 9e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REGV GK KS Sbjct: 727 ALSQSGTPRAKEKAQQLLSHFRNQREGVKGKGKS 760 >KRH67392.1 hypothetical protein GLYMA_03G163900 [Glycine max] Length = 792 Score = 59.7 bits (143), Expect = 9e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REGV GK KS Sbjct: 759 ALSQSGTPRAKEKAQQLLSHFRNQREGVKGKGKS 792 >XP_014629316.1 PREDICTED: U-box domain-containing protein 3-like isoform X5 [Glycine max] Length = 793 Score = 59.7 bits (143), Expect = 9e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REGV GK KS Sbjct: 760 ALSQSGTPRAKEKAQQLLSHFRNQREGVKGKGKS 793 >KHN02500.1 U-box domain-containing protein 3 [Glycine soja] Length = 774 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK KS Sbjct: 741 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 774 >KRG95671.1 hypothetical protein GLYMA_19G165200 [Glycine max] Length = 795 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK KS Sbjct: 762 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 795 >XP_006604492.1 PREDICTED: U-box domain-containing protein 3-like isoform X3 [Glycine max] Length = 796 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK KS Sbjct: 763 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 796 >XP_010101417.1 U-box domain-containing protein 3 [Morus notabilis] EXB88383.1 U-box domain-containing protein 3 [Morus notabilis] Length = 807 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK KS Sbjct: 774 ALSQSGTPRAKEKAQQLLSHFRNQREGTTGKGKS 807 >KRG95673.1 hypothetical protein GLYMA_19G165200 [Glycine max] Length = 812 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK KS Sbjct: 779 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 812 >KYP70744.1 U-box domain-containing protein 3, partial [Cajanus cajan] Length = 745 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK KS Sbjct: 712 ALSQSGTPRAKEKAQQLLSHFRNQREGAMGKGKS 745 >KJB11338.1 hypothetical protein B456_001G254100 [Gossypium raimondii] Length = 590 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAK 305 ALS SGTPRAKEKAQQ+LSHFR++REG GK+K Sbjct: 558 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 590 >XP_016746707.1 PREDICTED: U-box domain-containing protein 3-like isoform X2 [Gossypium hirsutum] Length = 681 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAK 305 ALS SGTPRAKEKAQQ+LSHFR++REG GK+K Sbjct: 649 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 681 >XP_016749956.1 PREDICTED: U-box domain-containing protein 3-like isoform X2 [Gossypium hirsutum] Length = 681 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAK 305 ALS SGTPRAKEKAQQ+LSHFR++REG GK+K Sbjct: 649 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 681 >XP_012442835.1 PREDICTED: U-box domain-containing protein 3-like isoform X2 [Gossypium raimondii] KJB11341.1 hypothetical protein B456_001G254100 [Gossypium raimondii] Length = 681 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAK 305 ALS SGTPRAKEKAQQ+LSHFR++REG GK+K Sbjct: 649 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 681 >EOX94436.1 ARM repeat superfamily protein isoform 2 [Theobroma cacao] Length = 750 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK K+ Sbjct: 717 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKT 750 >XP_016746705.1 PREDICTED: U-box domain-containing protein 3-like isoform X1 [Gossypium hirsutum] XP_016746706.1 PREDICTED: U-box domain-containing protein 3-like isoform X1 [Gossypium hirsutum] Length = 783 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAK 305 ALS SGTPRAKEKAQQ+LSHFR++REG GK+K Sbjct: 751 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 783 >XP_016749955.1 PREDICTED: U-box domain-containing protein 3-like isoform X1 [Gossypium hirsutum] Length = 783 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAK 305 ALS SGTPRAKEKAQQ+LSHFR++REG GK+K Sbjct: 751 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 783 >XP_012442820.1 PREDICTED: U-box domain-containing protein 3-like isoform X1 [Gossypium raimondii] XP_012442827.1 PREDICTED: U-box domain-containing protein 3-like isoform X1 [Gossypium raimondii] KJB11337.1 hypothetical protein B456_001G254100 [Gossypium raimondii] KJB11339.1 hypothetical protein B456_001G254100 [Gossypium raimondii] KJB11340.1 hypothetical protein B456_001G254100 [Gossypium raimondii] Length = 783 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAK 305 ALS SGTPRAKEKAQQ+LSHFR++REG GK+K Sbjct: 751 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 783 >XP_017613477.1 PREDICTED: U-box domain-containing protein 3-like [Gossypium arboreum] XP_017613482.1 PREDICTED: U-box domain-containing protein 3-like [Gossypium arboreum] KHG16511.1 U-box domain-containing 3 -like protein [Gossypium arboreum] Length = 783 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAK 305 ALS SGTPRAKEKAQQ+LSHFR++REG GK+K Sbjct: 751 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 783 >XP_017976788.1 PREDICTED: U-box domain-containing protein 3 [Theobroma cacao] Length = 786 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK K+ Sbjct: 753 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKT 786 >EOX94435.1 ARM repeat superfamily protein isoform 1 [Theobroma cacao] Length = 786 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 403 ALSMSGTPRAKEKAQQILSHFRDRREGVNGKAKS 302 ALS SGTPRAKEKAQQ+LSHFR++REG GK K+ Sbjct: 753 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKT 786